AMD1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• AMD1 Polyclonal antibody, PBS Only (29108-1-PBS)

• 

  WB analysis using 29108-1-AP (same clone as 29108-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 29108-1-AP (AMD1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 29108-1-PBS in a different storage buffer formulation.

AMD1 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 29108-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

29108-1-PBS targets AMD1 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30751

  Product name: Recombinant human AMD1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 149-334 aa of BC000171

  Sequence: MGRMNSDCWYLYTLDFPESRVISQPDQTLEILMSELDPAVMDQFYMKDGVTAKDVTRESGIRDLIPGSVIDATMFNPCGYSMNGMKSDGTYWTIHITPEPEFSYVSFETNLSQTSYDDLIRKVVEVFKPGKFVTTLFVNQSSKCRTVLASPQKIEGFKRLDCQSAMFNDYNFVFTSFAKKQQQQQS

• Full Name: adenosylmethionine decarboxylase 1
• Calculated Molecular Weight: 38 kDa, 32 kDa
• Observed Molecular Weight: 30-40 kDa
• GenBank Accession Number: BC000171
• Gene Symbol: AMD1
• Gene ID (NCBI): 262
• RRID: AB_3086098
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P17707
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.