AMELX Polyclonal antibody

• 

AMELX Polyclonal Antibody for ELISA

Cat No. 17992-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

ELISA

Synonyms

AIH1, ALGN, Amelogenin, X isoform, AMELX, AMG, AMGL, AMGX

---

Product Information

17992-1-AP targets AMELX in ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12430

  Product name: Recombinant human AMELX protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 25-191 aa of BC074951

  Sequence: HPGYINFSYEVLTPLKWYQSIRPPYPSYGYEPMGGWLHHQIIPVLSQQHPPTHTLQPHHHIPVVPAQQPVIPQQPMMPVPGQHSMTPIQHHQPNLPPPAQQPYQPQPVQPQPHQPMQPQPPVHPMQPLPPQPPLPPMFPMQPLPPMLPDLTLEAWPSTDKTKREEVD

• Full Name: amelogenin (amelogenesis imperfecta 1, X-linked)
• Calculated Molecular Weight: 191 aa, 22 kDa
• GenBank Accession Number: BC074951
• Gene Symbol: AMELX
• Gene ID (NCBI): 265
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q99217
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.