AMIGO3 Polyclonal antibody

• 

  WB analysis of MCF-7 using 21278-1-AP

  MCF7 cells were subjected to SDS PAGE followed by western blot with 21278-1-AP (AMIGO3 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse kidney using 21278-1-AP

  mouse kidney tissue were subjected to SDS PAGE followed by western blot with 21278-1-AP (AMIGO3 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human brain using 21278-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 21278-1-AP (AMIGO3 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse ovary using 21278-1-AP

  mouse ovary tissue were subjected to SDS PAGE followed by western blot with 21278-1-AP (AMIGO3 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 21278-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 21278-1-AP (AMIGO3 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of L02 using 21278-1-AP

  L02 cells were subjected to SDS PAGE followed by western blot with 21278-1-AP (AMIGO3 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  IF Staining of MCF-7 using 21278-1-AP

  Immunofluorescent analysis of (4% PFA) fixed MCF-7 cells using 21278-1-AP (AMIGO3 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).

AMIGO3 Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 21278-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, ELISA

Synonyms

Amphoterin induced protein 3, AMIGO-3, AMIGO 3, Alivin-3, Alivin 3

---

Tested Applications

• Positive WB detected in: MCF7 cells, HeLa cells, human brain tissue, L02 cells, mouse kidney tissue, mouse ovary tissue
• Positive IF/ICC detected in: MCF-7 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

21278-1-AP targets AMIGO3 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15790

  Product name: Recombinant human AMIGO3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 221-504 aa of BC110418

  Sequence: LPCDCRLYHLLQRWHQRGLSAVRDFAREYVCLAFKVPASRVRFFQHSRVFENCSSAPALGLERPEEHLYALVGRSLRLYCNTSVPAMRIAWVSPQQELLRAPGSRDGSIAVLADGSLAIGNVQEQHAGLFVCLATGPRLHHNQTHEYNVSVHFPRPEPEAFNTGFTTLLGCAVGLVLVLLYLFAPPCRCCRRACRCRRWPQTPSPLQELSAQSSVLSTTPPDAPSRKASVHKHVVFLEPGRRGLNGRVQLAVAEEFDLYNPGGLQLKAGSESASSIGSEGPMTT

• Full Name: adhesion molecule with Ig-like domain 3
• Calculated Molecular Weight: 504 aa, 55 kDa
• Observed Molecular Weight: 45-50 kDa
• GenBank Accession Number: BC110418
• Gene Symbol: AMIGO3
• Gene ID (NCBI): 386724
• RRID: AB_10733101
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q86WK7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.