AMN Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• AMN Polyclonal antibody, PBS Only (32038-1-PBS)

• 

  WB analysis using 32038-1-AP (same clone as 32038-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 32038-1-AP (AMN antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 32038-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 32038-1-AP (same clone as 32038-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using AMN antibody (32038-1-AP) at dilution of 1:400 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002). This data was developed using the same antibody clone with 32038-1-PBS in a different storage buffer formulation.

AMN Polyclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 32038-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

32038-1-PBS targets AMN in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag35205

  Product name: Recombinant human AMN protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 20-204 aa of NM_030943.3

  Sequence: VSKLWVPNTDFDVAANWSQNRTPCAGGAVEFPADKMVSVLVQEGHAVSDMLLPLDGELVLASGAGFGVSDVGSHLDCGAGEPAVFRDSDRFSWHDPHLWRSGDEAPGLFFVDAERVPCRHDDVFFPPSASFRVGLGPGASPVRVRSISALGRTFTRDEDLAVFLASRAGRLRFHGPGALSVGPED

• Full Name: amnionless homolog (mouse)
• Calculated Molecular Weight: 48 kDa
• Observed Molecular Weight: 48 kDa
• GenBank Accession Number: NM_030943.3
• Gene Symbol: AMN
• Gene ID (NCBI): 81693
• RRID: AB_3670177
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q9BXJ7
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Amnion associated transmembrane protein (AMN, also known as IGS2, PRO1028, and amnionless) is a 45-50 kDa cysteine-rich type I transmembrane protein that is expressed exclusively in the extra-embryonic visceral endoderm layer during gastrulation (PMID: 17990981; 11279523). It may direct the production of trunk mesoderm derived from the middle streak by acting in the underlying visceral endoderm to modulate a BMP signaling pathway (PMID: 11279523).