AMPK Beta 2 Monoclonal antibody, PBS Only

• 

  WB analysis using 66579-1-Ig (same clone as 66579-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66579-1-Ig (AMPK beta 2 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66579-1-PBS in a different storage buffer formulation.

• 

  WB analysis of A431 using 66579-1-Ig (same clone as 66579-1-PBS)

  A431 cells were subjected to SDS PAGE followed by western blot with 66579-1-Ig (AMPK beta 2 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66579-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 66579-1-Ig (same clone as 66579-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 66579-1-Ig (AMPK beta 2 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66579-1-PBS in a different storage buffer formulation.

• 

  WB analysis of A549 using 66579-1-Ig (same clone as 66579-1-PBS)

  A549 cells were subjected to SDS PAGE followed by western blot with 66579-1-Ig (AMPK beta 2 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66579-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 66579-1-Ig (same clone as 66579-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using AMPK Beta 2 antibody (66579-1-Ig, Clone: 2D5C1 ) at dilution of 1:800 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 66579-1-PBS in a different storage buffer formulation.

AMPK Beta 2 Monoclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 66579-1-PBS

Clone No.2D5C1

Host / Isotype

Mouse / IgG1

Reactivity

Human, mouse, rat

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

AMPK subunit beta 2, PRKAB2

---

Product Information

66579-1-PBS targets AMPK Beta 2 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with Human, mouse, rat samples.

• Tested Reactivity: Human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5806

  Product name: Recombinant human PRKAB2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-272 aa of BC053610

  Sequence: MGNTTSDRVSGERHGAKAARSEGAGGHAPGKEHKIMVGSTDDPSVFSLPDSKLPGDKEFVSWQQDLEDSVKPTQQARPTVIRWSEGGKEVFISGSFNNWSTKIPLIKSHNDFVAILDLPEGEHQYKFFVDGQWVHDPSEPVVTSQLGTINNLIHVKKSDFEVFDALKLDSMESSETSCRDLSSSPPGPYGQEMYAFRSEERFKSPPILPPHLLQVILNKDTNISCDPALLPEPNHVMLNHLYALSIKDSVMVLSATHRYKKKYVTTLLYKPI

• Full Name: protein kinase, AMP-activated, beta 2 non-catalytic subunit
• Calculated Molecular Weight: 30 kDa
• Observed Molecular Weight: 33 kDa
• GenBank Accession Number: BC053610
• Gene Symbol: AMPK Beta 2
• Gene ID (NCBI): 5565
• RRID: AB_2881939
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: O43741
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

AMPK beta 2 is a regulatory subunit of the AMP-activated protein kinase (AMPK), which is a heterotrimer consisting of an alpha catalytic subunit, and non-catalytic beta and gamma subunits. AMPK is an important energy-sensing enzyme that monitors cellular energy status. In response to cellular metabolic stresses, AMPK is activated, and thus phosphorylates and inactivates acetyl-CoA carboxylase (ACC) and beta-hydroxy beta-methylglutaryl-CoA reductase (HMGCR), key enzymes involved in regulating de novo biosynthesis of fatty acid and cholesterol. AMPK beta 2 may be a positive regulator of AMPK activity. It is highly expressed in skeletal muscle and thus may have tissue-specific roles.