Use Able AI chat for product recommendations

AMPK Gamma 1 Recombinant monoclonal antibody

AMPK Gamma 1 Uni-rAb® Recombinant Antibody for WB, ELISA

Cat No. 88030-2-RR
Clone No.260133A3

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

PRKAG1, 5'-AMP-activated protein kinase subunit gamma-1, AMPK gamma1, AMPK subunit gamma 1, AMPK subunit gamma-1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHepG2 cells, Jurkat cells, K-562 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

88030-2-RR targets AMPK Gamma 1 in WB, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag0302

Product name: Recombinant human PRKAG1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 165-321 aa of BC000358

Sequence: LYILTHKRILKFLKLFITEFPKPEFMSKSLEELQIGTYANIAMVRTTTPVYVALGIFVQHRVSALPVVDEKGRVVDIYSKFDVINLAAEKTYNNLDVSVTKALQHRSHYFEGVLKCYLHETLETIINRLVEAEVHRLVVVDENDVVKGIVSLSDILQA

Predict reactive species
Full Name protein kinase, AMP-activated, gamma 1 non-catalytic subunit
Calculated Molecular Weight 38 kDa
Observed Molecular Weight38 kDa
GenBank Accession NumberBC000358
Gene Symbol AMPK Gamma 1
Gene ID (NCBI) 5571
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP54619
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Protein kinase, AMP-activated, gamma 1 non-catalytic subunit (PRKAG1, synonyms: AMPKG, MGC8666) is a regulatory subunit of the AMP-activated protein kinase (AMPK). AMPK is a heterotrimer consisting of an catalytic subunit, and non-catalytic and subunits. AMPK is an important energy-sensing enzyme that monitors cellular energy status. In response to cellular metabolic stresses, AMPK is activated, and thus phosphorylates and iAMP-activated protein kinase (AMPK) is a highly conserved heterotrimeric serine/threonine kinase widely characterised as a sensor of cellular energetic stress. AMPK is a heterotrimeric complex consisting of a catalytic α-subunit and two regulatory subunits (β and γ). AMPK is an important energy-sensing enzyme that monitors cellular energy status. In response to cellular metabolic stresses, AMPK is activated, and thus phosphorylates and inactivates acetyl-CoA carboxylase (ACC) and beta-hydroxy beta-methylglutaryl-CoA reductase (HMGCR), key enzymes involved in regulating de novo biosynthesis of fatty acid and cholesterol. AMPK gamma 1 is one of the gamma regulatory subunits of AMPK.

Protocols

Product Specific Protocols
WB protocol for AMPK Gamma 1 antibody 88030-2-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...