AMPK Beta 1 Polyclonal antibody

AMPK Beta 1 Polyclonal Antibody for WB, ELISA
Cat No. 26907-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

PRKAB1, AMPKb, AMPK β, AMPK subunit beta-1, AMPK subunit beta 1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA431 cells, Jurkat cells, NIH/3T3 cells, HeLa cells, PC-12 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

26907-1-AP targets AMPK Beta 1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag25534

Product name: Recombinant human PRKAB1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-70 aa of BC001056

Sequence: MGNTSSERAALERHGGHKTPRRDSSGGTKDGDRPKILMDSPEDADLFHSEEIKAPEKEEFLAWQHDLEVN

Predict reactive species
Full Name protein kinase, AMP-activated, beta 1 non-catalytic subunit
Calculated Molecular Weight 30 kDa
Observed Molecular Weight 38 kDa
GenBank Accession NumberBC001056
Gene Symbol PRKAB1
Gene ID (NCBI) 5564
RRIDAB_2880679
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9Y478
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

AMPK Beta 1 (5'-AMP-activated protein kinase subunit beta-1) is also named as PRKAB1 and AMPK. AMPK, a serine/threonine kinase that exists as a heterotrimer comprised of a catalytic α-subunit and regulatory β- and γ-subunits, has been recognized as a sensor of cellular energy homeostasis (PMID: 21937710). AMPK regulates key metabolic enzymes, cell growth, apoptosis, gene transcription, and protein synthesis (PMID: 12829246). AMPK is an energy sensor and plays an essential role in the control of cellular bioenergetics by responding to various stresses including those that induce changes in the cellular AMP:ATP ratio or modulation in intracellular calcium (PMID: 27812976, PMID: 26616193). Recent studies have shown that AMPK mediates the inhibition of cell proliferation and growth of tumor cells (PMID: 16613876). AMPK also inhibits the expression of Glut1 and glycolysis in Tregs by inhibiting mTORC1 signaling (PMID: 25477880).

Protocols

Product Specific Protocols
WB protocol for AMPK Beta 1 antibody 26907-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...