Aminomethyltransferase Polyclonal antibody

• Home
• Products
• Primary Antibodies
• Aminomethyltransferase Polyclonal antibody (10633-1-AP)

Aminomethyltransferase Polyclonal Antibody for IHC, ELISA

Cat No. 10633-1-AP Copied!

Publications (3)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, ELISA

Synonyms

Aminomethyltransferase, AMT, GCE, GCST, GCVT, NKH

• 

  WB analysis using 10633-1-AP

  mouse kidney tissue were subjected to SDS PAGE followed by western blot with 10633-1-AP (Aminomethyltransferase antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse liver using 10633-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 10633-1-AP (Aminomethyltransferase antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for Aminomethyltransferase in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse kidney tissue
• Positive IHC detected in: mouse liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

10633-1-AP targets Aminomethyltransferase in IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0990

  Product name: Recombinant human AMT protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 83-383 aa of BC007546

  Sequence: QTKILGSDRVKLMESLVVGDIAELRPNQGTLSLFTNEAGGILDDLIVTNTSEGHLYVVSNAGCWEKDLALMQDKVRELQNQGRDVGLEVLDNALLALQGPTAAQVLQAGVADDLRKLPFMTSAVMEVFGVSGCRVTRCGYTGEDGVEISVPVAGAVHLATAILKNPEVKLAGLAARDSLRLEAGLCLYGNDIDEHTTPVEGSLSWTLGKRRRAAMDFPGAKVIVPQLKGRVQRRRVGLMCEGAPMRAHSPILNMEGTKIGTVTSGCPSPSLKKNVAMGYVPCEYSRPGTMLLVELPSGPCF

• Full Name: aminomethyltransferase
• Calculated Molecular Weight: 44 kDa
• Observed Molecular Weight: 40 kDa
• GenBank Accession Number: BC007546
• Gene Symbol: AMT
• Gene ID (NCBI): 275
• RRID: AB_2305496
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P48728
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The Aminomethyltransferase (AMT) polyclonal antibody (Cat# 10633-1-AP) has 3 citations. These appear in Neuropharmacology, BMC Complementary Medicine and Therapies, and Biological Psychiatry: Global Open Science. The associated research fields include neuropharmacology (cerebral ischemia-reperfusion injury and pyroptosis), oncology (pediatric rhabdomyosarcoma metastasis), and neuroscience/epigenetics (neuron-specific glycine metabolism and tRNA epitranscriptomic regulation).

Automatically generated from the 3 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
		Neuropharmacology; Ligustilide ameliorates cerebral ischemia-reperfusion injury by inhibiting NLRP3 inflammasome-dependent pyroptosis through enhancing Nrf2 signaling; Authors - Yang Wang
mouse		BMC Complement Med Ther; Vincetoxicum arnottianum modulates motility features and metastatic marker expression in pediatric rhabdomyosarcoma by stabilizing the actin cytoskeleton.; Authors - Anna Adamus
mouse		Biol Psychiatry Glob Open Sci; Neuron-Specific Glycine Metabolism Links Transfer RNA Epitranscriptomic Regulation to Complex Behaviors; Authors - Jennifer Blaze