ANAPC10 Polyclonal antibody

• 

  WB analysis using 15788-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 15788-1-AP (ANAPC10 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human heart using 15788-1-AP

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 15788-1-AP (ANAPC10 Antibody) at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human heart using 15788-1-AP

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 15788-1-AP (ANAPC10 Antibody) at dilution of 1:200 (under 40x lens).

ANAPC10 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 15788-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

DOC1, APC10, Anaphase-promoting complex subunit 10, ANAPC 10

---

Tested Applications

• Positive WB detected in: mouse testis tissue, rat testis tissue
• Positive IHC detected in: human heart tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:100-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

15788-1-AP targets ANAPC10 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8487

  Product name: Recombinant human ANAPC10 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-185 aa of BC005217

  Sequence: MTTPNKTPPGADPKQLERTGTVREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKTLCIYADYKSDESYTPSKISVRVGNNFHNLQEIRQLELVEPSGWIHVPLTDNHKKPTRTFMIQIAVLANHQNGRDTHMRQIKIYTPVEESSIGKFPRCTTIDFMMYRSIR

• Full Name: anaphase promoting complex subunit 10
• Calculated Molecular Weight: 185 aa, 21 kDa
• Observed Molecular Weight: 20 kDa
• GenBank Accession Number: BC005217
• Gene Symbol: ANAPC10
• Gene ID (NCBI): 10393
• RRID: AB_3669220
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UM13
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Anaphase-promoting complex subunit 10 (Anapc10) is a component of the promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin ligase.Anapc10 recognizes ubiquitination-mediated degradation of substrates, and is expressed predominantly in the cytoplasm of spermatogonial and leptoblast cells.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Discov Oncol; ANAPC10 expression predicts poor prognosis in oral squamous cell carcinoma and promotes tumor growth via the PI3K/AKT/mTOR pathway; Authors - Jing Fang