ANAPC10 Recombinant monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• ANAPC10 Recombinant monoclonal antibody, PBS Only (83570-4-PBS)

• 

  IF Staining of HeLa using 83570-4-RR (same clone as 83570-4-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using ANAPC10 antibody (83570-4-RR, Clone: 240492E7 ) at dilution of 1:250 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 83570-4-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 83570-4-RR

  Biolayer interferometry (BLl) kinetic assays of 83570-4-RR against Human ANAPC10 were performed. The affinity constant is 0.141 nM.

ANAPC10 Uni-rAb^® Recombinant Antibody for IF/ICC, ELISA

Cat No. 83570-4-PBS

Clone No.240492E7

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC, ELISA

Synonyms

DOC1, APC10, Anaphase-promoting complex subunit 10, ANAPC 10, 240492E7

---

Product Information

83570-4-PBS targets ANAPC10 in IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag8487

  Product name: Recombinant human ANAPC10 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-185 aa of BC005217

  Sequence: MTTPNKTPPGADPKQLERTGTVREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKTLCIYADYKSDESYTPSKISVRVGNNFHNLQEIRQLELVEPSGWIHVPLTDNHKKPTRTFMIQIAVLANHQNGRDTHMRQIKIYTPVEESSIGKFPRCTTIDFMMYRSIR

• Full Name: anaphase promoting complex subunit 10
• Calculated Molecular Weight: 185 aa, 21 kDa
• GenBank Accession Number: BC005217
• Gene Symbol: ANAPC10
• Gene ID (NCBI): 10393
• RRID: AB_3671183
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q9UM13
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

The anaphase promoting complex/cyclosome (APC/C) is a cell cycle-regulated multimeric E3 ubiquitin ligase assembled from 13 individual subunits. The anaphase promoting complex subunit 10 (APC10) is a core subunit of APC/C that is highly conserved in humans. APC10 genetically and physically interacts with a series of subunits of the APC/C and is necessary for the ubiquitination activity of APC/C by enhancing the affinity of the APC/C for its substrate.