Angiopoietin 4 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Angiopoietin 4 Polyclonal antibody, PBS Only (33510-1-PBS)

• 

  WB analysis using 33510-1-AP (same clone as 33510-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 33510-1-AP (ANGPT4 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 33510-1-PBS in a different storage buffer formulation.

Angiopoietin 4 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 33510-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Indirect ELISA

Synonyms

ANG3, ANG-3, ANG4, ANG-4, Angiopoietin-3

---

Product Information

33510-1-PBS targets Angiopoietin 4 in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag36152

  Product name: Recombinant human ANGPT4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 25-290 aa of BC111976

  Sequence: TRQEADRGCETLVVQHGHCSYTFLLPKSEPCPPGPEVSRDSNTLQRESLANPLHLGKLPTQQVKQLEQALQNNTQWLKKLERAIKTILRSKLEQVQQQMAQNQTAPMLELGTSLLNQTTAQIRKLTDMEAQLLNQTSRMDAQMPETFLSTNKLENQLLLQRQKLQQLQGQNSALEKRLQALETKQQEELASILSKKAKLLNTLSRQSAALTNIERGLRGVRHNSSLLQDQQHSLRQLLVLLRHLVQERANASAPAFIMAGEQVFQD

• Full Name: angiopoietin 4
• Observed Molecular Weight: 57 kDa
• GenBank Accession Number: BC111976
• Gene Symbol: ANGPT4
• Gene ID (NCBI): 51378
• RRID: AB_3742996
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q9Y264
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.