ANGPTL2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• ANGPTL2 Polyclonal antibody (12316-1-AP)

• Featured Product
• KD/KO Validated

ANGPTL2 Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 12316-1-AP Copied!

Publications (25)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, IP, ELISA

Synonyms

angiopoietin like 2, Angiopoietin like protein 2, Angiopoietin related protein 2, Angiopoietin-like protein 2, ARP2

• 

  WB analysis using 12316-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 12316-1-AP (ANGPTL2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of 3T3-L1 using 12316-1-AP

  3T3-L1 cells were subjected to SDS PAGE followed by western blot with 12316-1-AP (ANGPTL2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse spleen using 12316-1-AP

  mouse spleen tissue were subjected to SDS PAGE followed by western blot with 12316-1-AP (ANGPTL2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of mouse testis using 12316-1-AP

  IP result of anti-ANGPTL2 (IP:12316-1-AP, 4ug; Detection:12316-1-AP 1:500) with mouse testis tissue lysate 4800ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 12316-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 12316-1-AP (ANGPTL2 antibody) at dilution of 1:200 (under 0x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 12316-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 12316-1-AP (ANGPTL2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human spleen using 12316-1-AP

  Immunohistochemical analysis of paraffin-embedded human spleen using 12316-1-AP (ANGPTL2 antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human spleen using 12316-1-AP

  Immunohistochemical analysis of paraffin-embedded human spleen using 12316-1-AP (ANGPTL2 antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human heart using 12316-1-AP

  Immunohistochemical analysis of paraffin-embedded human heart using 12316-1-AP (ANGPTL2 antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human heart using 12316-1-AP

  Immunohistochemical analysis of paraffin-embedded human heart using 12316-1-AP (ANGPTL2 antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for ANGPTL2 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: H9C2 cells, 3T3-L1 cells, mouse spleen tissue, mouse heart tissue, mouse small intestine, mouse testis tissue, rat heart tissue
• Positive IP detected in: mouse testis tissue
• Positive IHC detected in: human colon cancer tissue, human heart tissue, human spleen tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

12316-1-AP targets ANGPTL2 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2969

  Product name: Recombinant human ANGPTL2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 193-493 aa of BC012368

  Sequence: QSEIIAQLEEHCQRVPSARPVPQPPPAAPPRVYQPPTYNRIINQISTNEIQSDQNLKVLPPPLPTMPTLTSLPSSTDKPSGPWRDCLQALEDGHDTSSIYLVKPENTNRLMQVWCDQRHDPGGWTVIQRRLDGSVNFFRNWETYKQGFGNIDGEYWLGLENIYWLTNQGNYKLLVTMEDWSGRKVFAEYASFRLEPESEYYKLRLGRYHGNAGDSFTWHNGKQFTTLDRDHDVYTGNCAHYQKGGWWYNACAHSNLNGVWYRGGHYRSRYQDGVYWAEFRGGSYSLKKVVMMIRPNPNTFH

• Full Name: angiopoietin-like 2
• Calculated Molecular Weight: 493 aa, 57 kDa
• Observed Molecular Weight: 57-64 kDa
• GenBank Accession Number: BC012368
• Gene Symbol: ANGPTL2
• Gene ID (NCBI): 23452
• RRID: AB_2226307
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UKU9
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ANGPTL2 (angiopoietin-like 2), a member of the Angptl protein family, is predominantly secreted from adipose tissue and the heart. ANGPTL2 consists of an N-terminus with a conserved coiled-coil domain, two glycosylation sites and a C-terminus with a conserved fibrinogen-like domain. It is a key adipocyte-derived inflammatory mediator that links obesity to systemic INS resistance. ANGPTL2 may play an important role in the pathogenesis of diabetic glomerulopathy.

Publications

What published studies show

ANGPTL2 antibody (Cat# 12316-1-AP) has 25 citations published in journals including ACS Nano, Cell Death & Disease, Cell Reports, Nature Communications, FASEB Journal, Scientific Reports, Frontiers in Immunology, and World Journal of Gastroenterology. Research fields span oncology (colorectal, melanoma, glioma, prostate, gastric, and hepatocellular cancers), angiogenesis, periodontitis, rheumatoid arthritis, osteoarthritis, hypertension, diabetic wound healing, and aging.

Automatically generated from the 25 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
rat	WB	ACS Nano; Oxidation of Reduced Graphene Oxide via Cellular Redox Signaling Modulates Actin-Mediated Neurotransmission.; Authors - Yiyuan Kang
	IF	J Adv Res; Roles of Msx2 in exogen control: modulating the stem cell niche during the transition from hair shedding to regeneration; Authors - Qi Chen
human	WB,IHC	J Nanobiotechnology; Delivery of an ERK inhibitor using bioactive lipid nanoparticles reduces angiogenesis and prevents oral squamous cell carcinoma development; Authors - Zixian Huang
mouse	WB	Cell Death Dis; ANGPTL2 inhibits macrophage pyroptosis and alleviates rheumatoid arthritis progression by regulating mitophagy via IGFBP5.; Authors - Yuqi Liu ; KO Validated
human	WB	Cell Rep; Aged fibroblast-derived extracellular vesicles promote angiogenesis in melanoma; Authors - Laura Hüser
human	IHC	World J Gastroenterol; Leukocyte immunoglobulin-like receptor B2 overexpression as a promising therapeutic target and noninvasive screening biomarker for colorectal cancer; Authors - Qian-Qian Wang