ANGPTL4 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• ANGPTL4 Polyclonal antibody (31497-1-AP)

• 

  WB analysis of HEK-293 using 31497-1-AP

  WB result of ANGPTL4 antibody (31497-1-AP; 1:600; incubated at room temperature for 1.5 hours) with sh-Control and sh-ANGPTL4 transfected HEK-293 cells.

• 

  WB analysis using 31497-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 31497-1-AP (ANGPTL4 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human placenta using 31497-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 31497-1-AP (ANGPTL4 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human placenta using 31497-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 31497-1-AP (ANGPTL4 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HEK-293 using 31497-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HEK-293 cells using ANGPTL4 antibody (31497-1-AP) at dilution of 1:800 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

• 

  IF Staining of NIH/3T3 using 31497-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed NIH/3T3 cells using ANGPTL4 antibody (31497-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

• 

  IF Staining of HT-29 using 31497-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HT-29 cells using ANGPTL4 antibody (31497-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

ANGPTL4 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 31497-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

angiopoietin like 4, Angiopoietin like protein 4, Angiopoietin related protein 4, Angiopoietin-like protein 4, Angiopoietin-related protein 4

---

Tested Applications

• Positive WB detected in: mouse heart tissue, HEK-293 cells, rat heart tissue
• Positive IHC detected in: human placenta tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HEK-293 cells, NIH/3T3 cells, HT-29 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

31497-1-AP targets ANGPTL4 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag31212

  Product name: Recombinant human ANGPTL4 protein

  Source: e coli.-derived, PKG

  Tag: GST

  Domain: 26-200 aa of BC023647

  Sequence: GPVQSKSPRFASWDEMNVLAHGLLQLGQGLREHAERTRSQLSALERRLSACGSACQGTEGSTDLPLAPESRVDPEVLHSLQTQLKAQNSRIQQLFHKVAQQQRHLEKQHLRIQHLQSQFGLLDHKHLDHEVAKPARRKRLPEMAQPVDPAHNVSRLHRLPRDCQELFQVGERQSG

• Full Name: angiopoietin-like 4
• Calculated Molecular Weight: 45 kDa
• Observed Molecular Weight: 60 kDa
• GenBank Accession Number: BC023647
• Gene Symbol: ANGPTL4
• Gene ID (NCBI): 51129
• RRID: AB_3742439
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q9BY76
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Angiopoietin-like protein 4 (ANGPTL4), a member of the angiopoietin-like protein subfamily, is a secretory protein that functions as an important modulator of glucose and lipid metabolism. ANGPTL4 inhibits lipoprotein lipase (LPL)-dependent lipolysis thereby limiting the uptake of free fatty acids. Overexpression of ANGPTL4 results in hypertriglyceridemia, while ANGPTL4 deficiency suppresses foam formation in macrophages and protects against atherosclerosis. ANGPTL4 may play a role in several cancers and it also has been shown to prevent the metastatic process by inhibiting vascular activity as well as tumor cell motility and invasiveness. Decreased expression of this protein has been associated with type 2 diabetes.