Mouse ANGPTL4 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 86006-4-RR (same clone as 86006-4-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86006-4-RR (Angptl4 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86006-4-PBS in a different storage buffer formulation.

ANGPTL4 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 86006-4-PBS

Clone No.250335F5

Host / Isotype

Rabbit / IgG

Reactivity

mouse, rat

Applications

WB, Indirect ELISA

Synonyms

425O18-1, Angiopoietin-like protein 4, Angiopoietin-related protein 4, ANGPTL4 C-terminal chain, ANGPTL4 N-terminal chain

---

Product Information

86006-4-PBS targets ANGPTL4 in WB, Indirect ELISA applications and shows reactivity with mouse, rat samples.

• Tested Reactivity: mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg2770

  Product name: Recombinant Mouse ANGPTL4 protein (rFc Tag)

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 168-410 aa of NM_020581.2

  Sequence: RLPKMTQLIGLTPNATHLHRPPRDCQELFQEGERHSGLFQIQPLGSPPFLVNCEMTSDGGWTVIQRRLNGSVDFNQSWEAYKDGFGDPQGEFWLGLEKMHSITGNRGSQLAVQLQDWDGNAKLLQFPIHLGGEDTAYSLQLTEPTANELGATNVSPNGLSLPFSTWDQDHDLRGDLNCAKSLSGGWWFGTCSHSNLNGQYFHSIPRQRQERKKGIFWKTWKGRYYPLQATTLLIQPMEATAAS

• Full Name: angiopoietin-like 4
• Calculated Molecular Weight: 46 kDa
• Observed Molecular Weight: 45 kDa
• GenBank Accession Number: NM_020581.2
• Gene Symbol: Angptl4
• Gene ID (NCBI): 57875
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9Z1P8
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ANGPTL4 was first identified in adipose tissue and later found to be widely expressed in several tissues including the liver, skeletal muscle, small intestine, placenta, heart, and kidney. ANGPTL4 expression was first identified to be regulated by peroxisome proliferator-activator receptors (PPARs), PPARα and PPARγ.