ANKFY1 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 87415-1-RR (same clone as 87415-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 87415-1-RR (ANKFY1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 87415-1-PBS in a different storage buffer formulation.

ANKFY1 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 87415-1-PBS

Clone No.252707F7

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

ANKFY 1, ANKHZN, Ankyrin repeat and FYVE domain-containing protein 1, Rabankyrin-5, Rank-5

---

Product Information

87415-1-PBS targets ANKFY1 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag19267

  Product name: Recombinant human ANKFY1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 817-1170 aa of BC152991

  Sequence: GVIIQLLVSHPDIHLNVRDRQGLTPFACAMTFKNNKSAEAILKRESGAAEQVDNKGRNFLHVAVQNSDIESVLFLISVHANVNSRVQDASKLTPLHLAVQAGSEIIVRNLLLAGAKVNELTKHRQTALHLAAQQDLPTICSVLLENGVDFAAVDENGNNALHLAVMHGRLNNIRVLLTECTVDAEAFNLRGQSPLHILGQYGKENAAAIFDLFLECMPGYPLDKPDADGSTVLLLAYMKGNANLCRAIVRSGARLGVNNNQGVNIFNYQVATKQLLFRLLDMLSKEPPWCDGSYCYECTARFGVTTRKHHCRHCGRLLCHKCSTKEIPIIKFDLNKPVRVCNICFDVLTLGGVS

• Full Name: ankyrin repeat and FYVE domain containing 1
• Calculated Molecular Weight: 1169 aa, 129 kDa
• Observed Molecular Weight: 132 kDa
• GenBank Accession Number: BC152991
• Gene Symbol: ANKFY1
• Gene ID (NCBI): 51479
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9P2R3
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ANKFY1 also named as ANKHZN or Ankyrin repeats hooked to a zinc finger motif is a 1169 amino acid protein, which is a cytoplasm protein on embryonic stem cells. ANKFY1 protein is ubiquitously expressed in a spatiotemporal specific manner and is located on endosomes. ANKFY1 is expressed at various levels in human tissues and also present in both membrane and soluble fractions obtained on subcellular fractionation. ANKFY1 is a single copy gene consisting of predicted 25 exons in the human genome, and has been mapped to human chromosome 17p13.