ANKH Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ANKH Polyclonal antibody, PBS Only (20303-1-PBS)

• 

  WB analysis of HEK-293T using 20303-1-AP (same clone as 20303-1-PBS)

  HEK-293T cells were subjected to SDS PAGE followed by western blot with 20303-1-AP (ANKH Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20303-1-PBS in a different storage buffer formulation.

ANKH Polyclonal Antibody for WB, Indirect ELISA

Cat No. 20303-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

20303-1-PBS targets ANKH in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14125

  Product name: Recombinant human ANKH protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 200-337 aa of BC014526

  Sequence: GALVRCTTLCLGYYKNIHDIIPDRSGPELGGDATIRKMLSFWWPLALILATQRISRPIVNLFVSRDLGGSSAATEAVAILTATYPVGHMPYGWLTEIRAVYPAFDKNNPSNKLVSTSNTVTAAHIKKFTFVCMALSLT

• Full Name: ankylosis, progressive homolog (mouse)
• Calculated Molecular Weight: 492 aa, 54 kDa
• Observed Molecular Weight: 50 kDa
• GenBank Accession Number: BC014526
• Gene Symbol: ANKH
• Gene ID (NCBI): 56172
• RRID: AB_2878666
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9HCJ1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.