ANKRD18A Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ANKRD18A Polyclonal antibody, PBS Only (24087-1-PBS)

• 

  IHC staining of mouse liver using 24087-1-AP (same clone as 24087-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 24087-1-AP (ANKRD18A antibody) at dilution of 1:600 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 24087-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 24087-1-AP (same clone as 24087-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 24087-1-AP (ANKRD18A antibody) at dilution of 1:600 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 24087-1-PBS in a different storage buffer formulation.

ANKRD18A Polyclonal Antibody for IHC, Indirect ELISA

Cat No. 24087-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, Indirect ELISA

Synonyms

ankyrin repeat domain 18A, KIAA2015

---

Product Information

24087-1-PBS targets ANKRD18A in IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag21335

  Product name: Recombinant human ANKRD18A protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 262-390 aa of BC152434

  Sequence: NHLRNDNQETAAMKPANLKKRKERAKAEHNLKVASEEKQERLQRSENKQPQDSQSYGKKKDAMYGNFMLKKDIAMLKEELYAIKNDSLRKEKKYIQEIKSITEINANFEKSVRLNEKMITKTVARYSQQ

• Full Name: ankyrin repeat domain 18A
• Calculated Molecular Weight: 992 aa, 116 kDa
• GenBank Accession Number: BC152434
• Gene Symbol: ANKRD18A
• Gene ID (NCBI): 253650
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen Affinity purified
• UNIPROT ID: Q8IVF6
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ANKRD18A is an ankyrin repeat-containing protein that likely operates in the realm of epigenetic regulation, potentially influencing gene expression via DNA methylation mechanisms. Although its exact biochemical roles remain unclear, its frequent promoter hypermethylation in lung cancer, along with germline variation in vulvar skin disorders, underscores a compelling link to disease pathogenesis. Located on chromosome 9p13.1, ANKRD18A remains a compelling subject for further functional and clinical exploration.