ANKRD2 Recombinant monoclonal antibody

• 

  WB analysis using 87444-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 87444-1-RR (ANKRD2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 87444-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 87444-1-RR (ANKRD2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

ANKRD2 Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 87444-1-RR

Clone No.252829E11

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat, pig

Applications

WB, ELISA

Synonyms

Ankyrin repeat domain-containing protein 2, ARPP, hArpp

---

Tested Applications

• Positive WB detected in: mouse skeletal muscle tissue, human skeletal muscle tissue, pig skeletal muscle tissue, rat skeletal muscle tissue

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

87444-1-RR targets ANKRD2 in WB, ELISA applications and shows reactivity with human, mouse, rat, pig samples.

• Tested Reactivity: human, mouse, rat, pig
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag2389

  Product name: Recombinant human ANKRD2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-303 aa of BC020817

  Sequence: EAVMDGTMEDSEAVQRATALIEQRLAQEEENEKLRGDARQKLPMDLLVLEDEKHHGAQSAALQKVKGQERVRKTSLDLRREIIDVGGIQNLIELRKKRKQKKRDALAASHEPPPEPEEITGPVDEETFLKAAVEGKMKVIEKFLADGGSADTCDQFRRTALHRASLEGHMEILEKLLDNGATVDFQDRLDCTAMHWACRGGHLEVVKLLQSHGADTNVRDKEGDTALHDAVRLNRYKIIKLLLLHGADMMTKNLAGKTPTDLVQLWQADTRHALEHPEPGAEHNGLEGPNDSGRETPQPVPAQ

• Full Name: ankyrin repeat domain 2 (stretch responsive muscle)
• Calculated Molecular Weight: 37 aa, 2 kDa
• Observed Molecular Weight: 42 kDa
• GenBank Accession Number: BC020817
• Gene Symbol: ANKRD2
• Gene ID (NCBI): 26287
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9GZV1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ANKRD2 belongs to the conserved muscle ankyrin repeat protein (MARP) family. Expression of MARPs is induced in response to physiologic stress, injury, and hypertrophy. Together with Ankrd1/CARP and DARP, ANKRD2 are members of the MARP mechanosensing proteins that form a complex with titin (N2A)/calpain 3 protease/myopalladin. Ankrd2 is thought to have dual, structural and signaling roles, and could link the elastic I-band region as a stress sensor for transcriptional control in the nucleus.