ANKRD33 Polyclonal antibody

• 

  WB analysis of Y79 using 25202-1-AP

  Y79 cells were subjected to SDS PAGE followed by western blot with 25202-1-AP (ANKRD33 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human testis using 25202-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 25202-1-AP (ANKRD33 Antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human testis using 25202-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 25202-1-AP (ANKRD33 Antibody) at dilution of 1:50 (under 10x lens).

ANKRD33 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 25202-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

ANKRD33, ankyrin repeat domain 33, C12orf7

---

Tested Applications

• Positive WB detected in: Y79 cells
• Positive IHC detected in: human testis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

25202-1-AP targets ANKRD33 in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18582

  Product name: Recombinant human ANKRD33 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 73-272 aa of BC121153

  Sequence: AMRNRCECVATLLMAGADLTAVDPVRGKTALEWAVLTDSFDTVWRIRQLLRRPQVEQLSQHYKPEWPALSGLVAQAQAQAQVAPSLLERLQATLSLPFAPSPQEGGVLDHLVTATTSLASPFVTTACHTLCPDHPPSLGTRSKSVPELLVPAEAQSFRTPKSGPSSLAIPGAQDREEETGGGGQNGTEVGEDGIGQAGNR

• Full Name: ankyrin repeat domain 33
• Calculated Molecular Weight: 452 aa, 49 kDa
• Observed Molecular Weight: 49 kDa
• GenBank Accession Number: BC121153
• Gene Symbol: ANKRD33
• Gene ID (NCBI): 341405
• RRID: AB_2879956
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q7Z3H0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Ankyrin repeat domain 33 (ANKRD33), also named as C12orf7, belongs to the ankyrin repeat family and is highly expressed in retina. ANKRD33 exists as two isoforms. The isoform 1 molecular weight is 29kDa and isoform 2 is 49kDa. The function of ANKRD33 is still non-known.