ANKRD39 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ANKRD39 Polyclonal antibody, PBS Only (24027-1-PBS)

• 

  WB analysis of PC-3 using 24027-1-AP (same clone as 24027-1-PBS)

  PC-3 cells were subjected to SDS PAGE followed by western blot with 24027-1-AP (ANKRD39 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24027-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Transfected HEK-293 using 24027-1-AP (same clone as 24027-1-PBS)

  Transfected HEK-293 cells were subjected to SDS PAGE followed by western blot with 24027-1-AP (ANKRD39 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24027-1-PBS in a different storage buffer formulation.

• 

  IF Staining of PC-3 using 24027-1-AP (same clone as 24027-1-PBS)

  Immunofluorescent analysis of (-20℃ Ethanol) fixed PC-3 cells using 24027-1-AP (ANKRD39 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 24027-1-PBS in a different storage buffer formulation.

ANKRD39 Polyclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 24027-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

24027-1-PBS targets ANKRD39 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag21210

  Product name: Recombinant human ANKRD39 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 1-183 aa of BC031303

  Sequence: MATPRPCADGPCCSHPSAVLGVQQTLEEMDFERGIWSAALNGDLGRVKHLIQKAEDPSQPDSAGYTALHYASRNGHYAVCQFLLESGAKCDAQTHGGATALHRASYCGHTEITRLLLSHGSNPRVVDDDGMTSLHKAAERGHGDICSLLLQHSPALKAIRDRKARLACDLLPCNSDLRDLLSS

• Full Name: ankyrin repeat domain 39
• Calculated Molecular Weight: 183 aa, 20 kDa
• Observed Molecular Weight: 20-25 kDa
• GenBank Accession Number: BC031303
• Gene Symbol: ANKRD39
• Gene ID (NCBI): 51239
• RRID: AB_2879407
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q53RE8
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.