ANKRD46 Polyclonal antibody

• 

  WB analysis using 27568-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27568-1-AP (ANKRD46 antibody) at dilution of 1:2500 incubated at room temperature for 1.5 hours.

• 

  IF Staining of HEK-293 using 27568-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HEK-293 cells using ANKRD46 antibody (27568-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2).

ANKRD46 Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 27568-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, ELISA

Synonyms

Ankyrin repeat domain-containing protein 46, ankyrin repeat domain 46, ANK-S

---

Tested Applications

• Positive WB detected in: mouse brain tissue, rat brain tissue
• Positive IF/ICC detected in: HEK-293 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:5000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

27568-1-AP targets ANKRD46 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26623

  Product name: Recombinant human ANKRD46 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-189 aa of BC060843

  Sequence: MSYVFVNDSSQTNVPLLQACIDGDFNYSKRLLESGFDPNIRDSRGRTGLHLAAARGNVDICQLLHKFGADLLATDYQGNTALHLCGHVDTIQFLVSNGLKIDICNHQGATPLVLAKRRGVNKDVIRLLESLEEQEVKGFNRGTHSKLETMQTAESESAMESHSLLNPNLQQGEGVLSSFRTTWQEFVED

• Full Name: ankyrin repeat domain 46
• Observed Molecular Weight: 25 kDa
• GenBank Accession Number: BC060843
• Gene Symbol: ANKRD46
• Gene ID (NCBI): 157567
• RRID: AB_3669610
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q86W74
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ANKRD46 encodes a protein containing multiple ankyrin repeats. Ankyrin domains function in protein-protein interactions in a variety of cellular processes. ANKRD46 also known as ankyrin repeat small protein (ANK-S), is a 228-amino acid single-pass membrane protein(PMID: 21219636).