ANO10 Polyclonal antibody

• 

  WB analysis of mouse brain using 21901-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 21901-1-AP (ANO10 Antibody) at dilution of 1:1000 incubated at 4 degree celsius over night.

• 

  WB analysis of mouse brain using 21901-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 21901-1-AP (ANO10 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse brain using 21901-1-AP

  IP result of anti-ANO10 (IP:21901-1-AP, 3ug; Detection:21901-1-AP 1:500) with mouse brain tissue lysate 3600ug.

• 

  IHC staining of human testis using 21901-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 21901-1-AP (ANO10 Antibody) at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human testis using 21901-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 21901-1-AP (ANO10 Antibody) at dilution of 1:200 (under 40x lens).

ANO10 Polyclonal Antibody for WB, IP, IHC, ELISA

Cat No. 21901-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IP, IHC, ELISA

Synonyms

ANO10, anoctamin 10, TMEM16K, Transmembrane protein 16K

---

Tested Applications

• Positive WB detected in: mouse brain tissue
• Positive IP detected in: mouse brain tissue
• Positive IHC detected in: human testis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• IHC: See 1 publications below

Product Information

21901-1-AP targets ANO10 in WB, IP, IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13983

  Product name: Recombinant human ANO10 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-119 aa of BC038855

  Sequence: MLLGAEAVGLVKECNDNTMRAFTYRTRQNFKGFDDNNDDFLTMAECQFIIKHELENLRAKDEKMIPGYPQAKLYPGKSLLRRLLTSGIVIQVFPLHDSEALKKLEDTWYTRFALKYQPI

• Full Name: anoctamin 10
• Calculated Molecular Weight: 660 aa, 76 kDa
• Observed Molecular Weight: 76 kDa
• GenBank Accession Number: BC038855
• Gene Symbol: ANO10
• Gene ID (NCBI): 55129
• RRID: AB_2878940
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NW15
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ANO10, also named as TMEM16K, is 660 amino acid protein, which belongs to the anoctamin family. ANO10 does not exhibit calcium-activated chloride channel activity and can inhibit the activity of ANO1. ANO10 is Highly expressed in the brain. ANO10 may have an association with Spinocerebellar ataxia, autosomal recessive, 10.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IHC	Am J Cancer Res; ANO10 is a potential prognostic biomarker and correlates with immune infiltration in breast cancer; Authors - Ran Ning