ANO6 Polyclonal antibody

• 

  WB analysis using 20784-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 20784-1-AP (ANO6 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse liver using 20784-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 20784-1-AP (ANO6 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse liver using 20784-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 20784-1-AP (ANO6 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse liver using 20784-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 20784-1-AP (ANO6 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse kidney using 20784-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 20784-1-AP (ANO6 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse kidney using 20784-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 20784-1-AP (ANO6 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

ANO6 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 20784-1-AP

Publications(6)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IHC, ELISA

Synonyms

ANO6, anoctamin 6, TMEM16F, Transmembrane protein 16F

---

Tested Applications

• Positive WB detected in: HeLa cells, mouse liver tissue, L02 cells
• Positive IHC detected in: mouse liver tissue, mouse kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 3 publications below
• IHC: See 3 publications below

Product Information

20784-1-AP targets ANO6 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse, pig
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13937

  Product name: Recombinant human ANO6 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-294 aa of BC098410

  Sequence: MKKMSRNVLLQMEEEEDDDDGDIVLENLGQTIVPDLGSLESQHDFRTPEFEEFNGKPDSLFFNDGQRRIDFVLVYEDESRKETNKKGTNEKQRRKRQAYESNLICHGLQLEATRSVLDDKLVFVKVHAPWEVLCTYAEIMHIKLPLKPNDLKNRSSAFGTLNWFTKVLSVDESIIKPEQEFFTAPFEKNRMNDFYIVDRDAFFNPATRSRIVYFILSRVKYQVINNVSKFGINRLVNSGIYKAAFPLHDCKFRRQSEDPSCPNERYLLYREWAHPRSIYKKQPLDLIRKYYGEK

• Full Name: anoctamin 6
• Calculated Molecular Weight: 910 aa, 106 kDa
• Observed Molecular Weight: 95 kDa
• GenBank Accession Number: BC098410
• Gene Symbol: ANO6
• Gene ID (NCBI): 196527
• RRID: AB_2878737
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q4KMQ2
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IHC	Medicine (Baltimore); ANO6 is a reliable prognostic biomarker and correlates to macrophage polarization in breast cancer; Authors - Long-Huan Tang
human	IHC	Lab Med; Identification of biomarkers associated with pathological tumor staging and their utility in the diagnosis and prognosis of prostate cancer; Authors - Shiquan Xu
mouse		Life Sci; Benzbromarone improves blood hypercoagulability after TBI by reducing phosphatidylserine externalization through inhibition of TMEM16F expression; Authors - Kaiji Li
human	WB	Open Med (Wars); ANO6 (TMEM16F) inhibits gastrointestinal stromal tumor growth and induces ferroptosis; Authors - Hao Wang
mouse,human	WB,IHC	Neural Regen Res; TMEM16F may be a new therapeutic target for Alzheimer's disease; Authors - Zhi-Qiang Cui
pig	WB	Metabolites; Decreased Hyocholic Acid and Lysophosphatidylcholine Induce Elevated Blood Glucose in a Transgenic Porcine Model of Metabolic Disease; Authors - Jianping Xu

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Christelle (Verified Customer) (04-22-2022)

nothing

• Applications: Western Blot
• Primary Antibody Dilution: 1/500
• Cell Tissue Type: lymphocytes B immortalized