ANT1/2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ANT1/2 Polyclonal antibody, PBS Only (15997-1-PBS)

• 

  WB analysis of human heart using 15997-1-AP (same clone as 15997-1-PBS)

  human heart tissue were subjected to SDS PAGE followed by western blot with 15997-1-AP (ANT1/2 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15997-1-PBS in a different storage buffer formulation.

• 

  WB analysis of MCF-7 using 15997-1-AP (same clone as 15997-1-PBS)

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 15997-1-AP (ANT1/2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15997-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse skeletal muscle using 15997-1-AP (same clone as 15997-1-PBS)

  mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 15997-1-AP (ANT1/2antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15997-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse brain using 15997-1-AP (same clone as 15997-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 15997-1-AP (ANT1/2antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15997-1-PBS in a different storage buffer formulation.

• 

  IP experiment of mouse heart using 15997-1-AP (same clone as 15997-1-PBS)

  IP result of anti-ANT1/2 (IP:15997-1-AP, 4ug; Detection:15997-1-AP 1:500) with mouse heart tissue lysate 4000ug. This data was developed using the same antibody clone with 15997-1-PBS in a different storage buffer formulation.

ANT1/2 Polyclonal Antibody for WB, IP, Indirect ELISA

Cat No. 15997-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

Synonyms

SLC25A4, AAC1, ADP,ATP carrier protein 1, ADP/ATP translocase 1, ANT

---

Product Information

15997-1-PBS targets ANT1/2 in applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7787

  Product name: Recombinant human SLC25A4 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-298 aa of BC008664

  Sequence: MGDHAWSFLKDFLAGGVAAAVSKTAVAPIERVKLLLQVQHASKQISAEKQYKGIIDCVVRIPKEQGFLSFWRGNLANVIRYFPTQALNFAFKDKYKQLFLGGVDRHKQFWRYFAGNLASGGAAGATSLCFVYPLDFARTRLAADVGKGAAQREFHGLGDCIIKIFKSDGLRGLYQGFNVSVQGIIIYRAAYFGVYDTAKGMLPDPKNVHIFVSWMIAQSVTAVAGLVSYPFDTVRRRMMMQSGRKGADIMYTGTVDCWRKIAKDEGAKAFFKGAWSNVLRGMGGAFVLVLYDEIKKYV

• Full Name: solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 4
• Calculated Molecular Weight: 33 kDa
• Observed Molecular Weight: 33 kDa
• GenBank Accession Number: BC008664
• Gene Symbol: SLC25A4
• Gene ID (NCBI): 291
• RRID: AB_2190199
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P12235
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Adenine nucleotide translocators (ANTs) are mitochondrial carrier proteins that exchange ATP and ADP between the cytoplasm and the mitochondrial matrix. Four isoforms of ANT were identified: ANT1 (encoded by SLC25A4) is highly expressed in different tissues; ANT2 (encoded by SLC25A5) is predominantly expressed in proliferating, regenerating, or undifferentiated cells; ANT3 is ubiquitously expressed; ANT4 is mainly expressed in testis and germ cells. This antibody recognizes both of ANT1 and ANT2.