Annexin V Recombinant monoclonal antibody

• 

  WB analysis using 83929-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 83929-1-RR (ANXA5 antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 83929-1-RR

  WB result of Annexin V antibody (83929-1-RR; 1:3000; incubated at room temperature for 1.5 hours) with sh-Control and sh-Annexin V transfected HeLa cells.

• 

  Affinity and Kinetic Characterization of 83929-1-RR

  Biolayer interferometry (BLl) kinetic assays of 83929-1-RR against Human ANXA5 were performed. The affinity constant is 13.4 nM.

• Featured Product
• KD/KO Validated

Annexin V Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 83929-1-RR

Clone No.240621D1

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

Annexin A5, ANXA5, 240621D1, Anchorin CII, Annexin 5

---

Tested Applications

• Positive WB detected in: HEK-293T cells, HeLa cells, HepG2 cells, K-562 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:16000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

83929-1-RR targets Annexin V in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag0741

  Product name: Recombinant human 0741 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-320 aa of BC001429

  Sequence: MAQVLRGTVTDFPGFDERADAETLRKAMKGLGTDEESILTLLTSRSNAQRQEISAAFKTLFGRDLLDDLKSELTGKFEKLIVALMKPSRLYDAYELKHALKGAGTNEKVLTEIIASRTPEELRAIKQVYEEEYGSSLEDDVVGDTSGYYQRMLVVLLQANRDPDAGIDEAQVEQDAQALFQAGELKWGTDEEKFITIFGTRSVSHLRKVFDKYMTISGFQIEETIDRETSGNLEQLLLAVVKSIRSIPAYLAETLYYAMKGAGTDDHTLIRVMVSRSEIDLFNIRKEFRKNFATSLYSMIKGDTSGDYKKALLLLCGEDD

• Full Name: annexin A5
• Calculated Molecular Weight: 36 kDa
• Observed Molecular Weight: 36 kDa
• GenBank Accession Number: BC001429
• Gene Symbol: Annexin V
• Gene ID (NCBI): 308
• RRID: AB_3671509
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: P08758
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Annexin A5 (ANXA5), is a member of the structurally related family of annexin proteins some of which have been implicated in membrane-related events along exocytotic and endocytotic pathways. Annexin 5 is a phospholipase A2 and protein kinase C inhibitory protein with calcium channel activity and a potential role in cellular signal transduction, inflammation, growth and differentiation. Annexin 5 has also been described as placental anticoagulant protein I, vascular anticoagulant-alpha, endonexin II, lipocortin V, placental protein 4 and anchorin CII.