ANXA8 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• ANXA8 Polyclonal antibody (33144-1-AP)

• 

  WB analysis using 33144-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 33144-1-AP (ANXA8 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

ANXA8 Polyclonal Antibody for WB, ELISA

Cat No. 33144-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

Annexin A8, Annexin VIII, Annexin-8, ANX8, VAC-beta

---

Tested Applications

• Positive WB detected in: Calu-1 cells, HeLa cells, mouse skin tissue, rat skin tissue

Recommended dilution

• Western Blot (WB): WB : 1:3000-1:8000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

33144-1-AP targets ANXA8 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag39741

  Product name: Recombinant human ANXA8 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 70-188 aa of BC073755

  Sequence: DLTETLKSELSGKFERLIVALMYPPYRYEAKELHDAMKGLGTKEGVIIEILASRTKNQLREIMKAYEEDYGSSLEEDIQADTSGYLERILVCLLQGSRDDVSSFVDPALALQDAQDLYA

• Full Name: annexin A8
• Calculated Molecular Weight: 36 kDa
• Observed Molecular Weight: 35 kDa
• GenBank Accession Number: BC073755
• Gene Symbol: ANXA8
• Gene ID (NCBI): 653145
• RRID: AB_3742869
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: P13928
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Annexin A8 (ANXA8) gene, a member of the annexin family, encodes an anticoagulant protein involved in blood coagulation cascade and acts as an indirect inhibitor of the thromboplastin-specific complex. ANXA8 promotes the proliferation of endometrial cells through the Akt signalling pathway (PMID: 30040162). The expression levels of multiple cellular factors, including EGFR, PI3K, Akt, mTOR, p70S6K and 4EBP1, in the epidermal growth factor receptor (EGFR) signaling pathway were also altered by ANXA8 knockdown or overexpression in A549 cells, which confirmed the activation of the EGFR/Akt/mTOR signaling pathway by ANXA8 (PMID: 34671007).