Tested Applications
| Positive IF-P detected in | human liver cancer tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
CL594-66834 targets VAP1/AOC3 in IF-P applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag5908 Product name: Recombinant human AOC3 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 408-763 aa of BC050549 Sequence: ATYVDWHFLLESQAPKTIRDAFCVFEQNQGLPLRRHHSDLYSHYFGGLAETVLVVRSMSTLLNYDYVWDTVFHPSGAIEIRFYATGYISSAFLFGATGKYGNQVSEHTLGTVHTHSAHFKVDLDVAGLENWVWAEDMVFVPMAVPWSPEHQLQRLQVTRKLLEMEEQAAFLVGSATPRYLYLASNHSNKWGHPRGYRIQMLSFAGEPLPQNSSMARGFSWERYQLAVTQRKEEEPSSSSVFNQNDPWAPTVDFSDFINNETIAGKDLVAWVTAGFLHIPHAEDIPNTVTVGNGVGFFLRPYNFFDEDPSFYSADSIYFRGDQDAGACEVNPLACLPQAAACAPDLPAFSHGGFSHN Predict reactive species |
| Full Name | amine oxidase, copper containing 3 (vascular adhesion protein 1) |
| Calculated Molecular Weight | 85 kDa |
| Observed Molecular Weight | 85-90 kDa |
| GenBank Accession Number | BC050549 |
| Gene Symbol | AOC3 |
| Gene ID (NCBI) | 8639 |
| RRID | AB_2920046 |
| Conjugate | CoraLite®594 Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 588 nm / 604 nm |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | Q16853 |
| Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
| Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
AOC3(membrane primary amine oxidase) is also name as copper amine oxidase, HPAO, SSAO, VAP1 and belongs to the copper/topaquinone oxidase family. It is expressed on the surface of endothelial cells and is involved in leukocyte trafficking between blood and tissues under physiologic and pathologic conditions (PMID:17947691). AOC3 is highly expressed in adipocytes and smooth muscle cells and it can be N- and O-glycosylated (PMID:16046623). AOC3 has molecular mass of 70-90kD, and can exsit as a homodimer(165-185kD) and trimer(240~260kD) (PMID:10595925, 8625974).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CL594 VAP1/AOC3 antibody CL594-66834 | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |



