CoraLite® Plus 488-conjugated VAP1/AOC3 Monoclonal antibody

• 

  IF Staining of human liver cancer using CL488-66834

  Immunofluorescent analysis of (4% PFA) fixed human liver cancer tissue using CoraLite® Plus 488 AOC3 antibody (CL488-66834, Clone: 2A6G3 ) at dilution of 1:200.

• 

  IF Staining of human liver cancer using CL488-66834

  Immunofluorescent analysis of (4% PFA) fixed human liver cancer tissue using CoraLite® Plus 488 AOC3 antibody (CL488-66834, Clone: 2A6G3 ) at dilution of 1:200.

VAP1/AOC3 Monoclonal Antibody for IF-P

Cat No. CL488-66834

Clone No.2A6G3

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

IF-P

Synonyms

AOC3, VAP1, 2A6G3, Amine oxidase [copper-containing] 3, Amine oxidase copper-containing 3

---

Tested Applications

• Positive IF-P detected in: human liver cancer tissue

Recommended dilution

• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-66834 targets VAP1/AOC3 in IF-P applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5908

  Product name: Recombinant human AOC3 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 408-763 aa of BC050549

  Sequence: ATYVDWHFLLESQAPKTIRDAFCVFEQNQGLPLRRHHSDLYSHYFGGLAETVLVVRSMSTLLNYDYVWDTVFHPSGAIEIRFYATGYISSAFLFGATGKYGNQVSEHTLGTVHTHSAHFKVDLDVAGLENWVWAEDMVFVPMAVPWSPEHQLQRLQVTRKLLEMEEQAAFLVGSATPRYLYLASNHSNKWGHPRGYRIQMLSFAGEPLPQNSSMARGFSWERYQLAVTQRKEEEPSSSSVFNQNDPWAPTVDFSDFINNETIAGKDLVAWVTAGFLHIPHAEDIPNTVTVGNGVGFFLRPYNFFDEDPSFYSADSIYFRGDQDAGACEVNPLACLPQAAACAPDLPAFSHGGFSHN

• Full Name: amine oxidase, copper containing 3 (vascular adhesion protein 1)
• Calculated Molecular Weight: 85 kDa
• Observed Molecular Weight: 85-90 kDa
• GenBank Accession Number: BC050549
• Gene Symbol: AOC3
• Gene ID (NCBI): 8639
• RRID: AB_2919378
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q16853
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

AOC3(membrane primary amine oxidase) is also name as copper amine oxidase, HPAO, SSAO, VAP1 and belongs to the copper/topaquinone oxidase family. It is expressed on the surface of endothelial cells and is involved in leukocyte trafficking between blood and tissues under physiologic and pathologic conditions (PMID:17947691). AOC3 is highly expressed in adipocytes and smooth muscle cells and it can be N- and O-glycosylated (PMID:16046623). AOC3 has molecular mass of 70-90kD, and can exsit as a homodimer(165-185kD) and trimer(240~260kD) (PMID:10595925, 8625974).