AP1B1 Recombinant monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• AP1B1 Recombinant monoclonal antibody, PBS Only (87859-1-PBS)

AP1B1 Uni-rAb^® Recombinant Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 87859-1-PBS

Clone No.253524A11

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

Adaptor protein complex AP-1 subunit beta-1, Adaptor-related protein complex 1 subunit beta-1, ADTB1, AP 1 complex subunit beta 1, AP-1 complex subunit beta-1

• 

  WB analysis using 87859-1-RR (same clone as 87859-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 87859-1-RR (AP1B1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 87859-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HEK-293 using 87859-1-RR (same clone as 87859-1-PBS)

  WB result of AP1B1 antibody (87859-1-RR; 1:3000; incubated at room temperature for 1.5 hours) with sh-Control and sh-AP1B1 transfected HEK-293 cells. This data was developed using the same antibody clone with 87859-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon using 87859-1-RR (same clone as 87859-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 87859-1-RR (AP1B1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 87859-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon using 87859-1-RR (same clone as 87859-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 87859-1-RR (AP1B1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 87859-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HepG2 using 87859-1-RR (same clone as 87859-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed HepG2 cells using AP1B1 antibody (87859-1-RR, Clone: 253524A11 ) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 87859-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  Affinity of 87859-1-RR

  Biolayer interferometry (BLI) kinetic assays of 87859-1-RR against Human AP1B1 were performed. The affinity constant is 11.0 nM.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Product Information

87859-1-PBS targets AP1B1 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag10417

  Product name: Recombinant human AP1B1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 671-919 aa of BC046242

  Sequence: NFVAPPTAAVPANLGAPIGSGLSDLFDLTSGVGTLSGSYVAPKAVGSISMDLQLTNKALQVMTDFAIQFNRNSFGLAPAAPLQVHAPLSPNQTVEISLPLSTVGSVMKMEPLNNLQVAVKNNIDVFYFSTLYPLHILFVEDGKMDRQMFLATWKDIPNENEAQFQIRDCPLNAEAASSKLQSSNIFTVAKRNVEGQDMLYQSLKLTNGIWVLAELRIQPGNPSCTLSLKCRAPEVSQHVYQAYETILKN

• Full Name: adaptor-related protein complex 1, beta 1 subunit
• Calculated Molecular Weight: 919 aa, 101 kDa
• Observed Molecular Weight: 101 kDa
• GenBank Accession Number: BC046242
• Gene Symbol: AP1B1
• Gene ID (NCBI): 162
• RRID: AB_3745792
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q10567
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

AP1B1 is a subunit of the adaptor complex AP-1 and is a member of the adaptin protein family. Adaptor protein (AP) complexes are cytosolic heterotetramers that mediate the sorting of membrane proteins in the secretory and endocytic pathways. AP-1 is found at the cytoplasmic face of coated vesicles located at the Golgi complex, where it mediates both the recruitment of clathrin to the membrane and the recognition of sorting signals within the cytosolic tails of transmembrane receptors. (PMID: 41117250)