AP1M1 Monoclonal antibody, PBS Only

• 

  WB analysis using 68726-1-Ig (same clone as 68726-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68726-1-Ig (AP1M1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68726-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 68726-1-Ig (same clone as 68726-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68726-1-Ig (AP1M1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68726-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human placenta using 68726-1-Ig (same clone as 68726-1-PBS)

  human placenta tissue were subjected to SDS PAGE followed by western blot with 68726-1-Ig (AP1M1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68726-1-PBS in a different storage buffer formulation.

• 

  WB analysis of A375 using 68726-1-Ig (same clone as 68726-1-PBS)

  A375 cells were subjected to SDS PAGE followed by western blot with 68726-1-Ig (AP1M1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68726-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 68726-1-Ig (same clone as 68726-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using AP1M1 antibody (68726-1-Ig, Clone: 1E9A11 ) at dilution of 1:400 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Mouse Recombinant Secondary Antibody (H+L) (RGAM002). This data was developed using the same antibody clone with 68726-1-PBS in a different storage buffer formulation.

AP1M1 Monoclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 68726-1-PBS

Clone No.1E9A11

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

AP-1 complex subunit mu-1, AP mu chain family member mu1A, AP 1 complex subunit mu 1, Adaptor-related protein complex 1 subunit mu-1, Adaptor protein complex AP-1 subunit mu-1

---

Product Information

68726-1-PBS targets AP1M1 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25303

  Product name: Recombinant human AP1M1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 164-423 aa of BC017469

  Sequence: IKYRKNEVFLDVIESVNLLVSANGNVLRSEIVGSIKMRVFLSGMPELRLGLNDKVLFDNTGRGKSKSVELEDVKFHQCVRLSRFENDRTISFIPPDGEFELMSYRLNTHVKPLIWIESVIEKHSHSRIEYMIKAKSQFKRRSTANNVEIHIPVPNDADSPKFKTTVGSVKWVPENSEIVWSIKSFPGGKEYLMRAHFGLPSVEAEDKEGKPPISVKFEIPYFTTSGIQVRYLKIIEKSGYQALPWVRYITQNGDYQLRTQ

• Full Name: adaptor-related protein complex 1, mu 1 subunit
• Calculated Molecular Weight: 423 aa, 49 kDa
• Observed Molecular Weight: 47-49 kDa
• GenBank Accession Number: BC017469
• Gene Symbol: AP1M1
• Gene ID (NCBI): 8907
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9BXS5
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

AP1M1, also named as CLTNM, Mu-adaptin 1 and Clathrin coat assembly protein AP47, belongs to the adaptor complexes medium subunit family. It is a subunit of clathrin-associated adaptor protein complex 1 that plays a role in protein sorting in the trans-Golgi network (TGN) and endosomes. The AP complexes mediate the recruitment of clathrin to membranes and the recognition of sorting signals within the cytosolic tails of transmembrane cargo molecules.