AP1M1 Recombinant monoclonal antibody, PBS Only (Detector)

AP1M1 Uni-rAb® Recombinant Antibody for Cytometric bead array, Indirect ELISA
Cat No. 83613-4-PBS
Clone No.240553C1

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Indirect ELISA

Adaptor protein complex AP-1 subunit mu-1, Adaptor-related protein complex 1 subunit mu-1, AP 1 complex subunit mu 1, AP mu chain family member mu1A, AP-1 complex subunit mu-1

Formulation:  PBS Only
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83613-4-PBS targets AP1M1 as part of a matched antibody pair:

MP00588-2: 83613-2-PBS capture and 83613-4-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag2757

Product name: Recombinant human AP1M1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 164-423 aa of BC017469

Sequence: IKYRKNEVFLDVIESVNLLVSANGNVLRSEIVGSIKMRVFLSGMPELRLGLNDKVLFDNTGRGKSKSVELEDVKFHQCVRLSRFENDRTISFIPPDGEFELMSYRLNTHVKPLIWIESVIEKHSHSRIEYMIKAKSQFKRRSTANNVEIHIPVPNDADSPKFKTTVGSVKWVPENSEIVWSIKSFPGGKEYLMRAHFGLPSVEAEDKEGKPPISVKFEIPYFTTSGIQVRYLKIIEKSGYQALPWVRYITQNGDYQLRTQ

Predict reactive species
Full Name adaptor-related protein complex 1, mu 1 subunit
Calculated Molecular Weight 423 aa, 49 kDa
GenBank Accession NumberBC017469
Gene Symbol AP1M1
Gene ID (NCBI) 8907
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9BXS5
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.
Loading...
||
New chat Able
正在加载,请稍候...