AP1S2 Polyclonal antibody

• 

  WB analysis using 15043-1-AP

  rat epididymis tissue was subjected to SDS PAGE followed by western blot with 15043-1-AP (AP1S2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

AP1S2 Polyclonal Antibody for WB, ELISA

Cat No. 15043-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

WB, ELISA

Synonyms

AP 1 complex subunit sigma 2, AP1S2, DC22, MRX59, Sigma adaptin 1B, SIGMA1B, Sigma1B adaptin

---

Tested Applications

• Positive WB detected in: rat epididymis tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

15043-1-AP targets AP1S2 in WB, ELISA applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6911

  Product name: Recombinant human AP1S2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-157 aa of BC001117

  Sequence: MQFMLLFSRQGKLRLQKWYVPLSDKEKKKITRELVQTVLARKPKMCSFLEWRDLKIVYKRYASLYFCCAIEDQDNELITLEIIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLLGGEVQETSKKNVLKAIEQADLLQEEAETPRSVLEEIGLT

• Full Name: adaptor-related protein complex 1, sigma 2 subunit
• Calculated Molecular Weight: 19 kDa
• Observed Molecular Weight: 19-24 kDa
• GenBank Accession Number: BC001117
• Gene Symbol: AP1S2
• Gene ID (NCBI): 8905
• RRID: AB_3669197
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P56377
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

AP1S2 is a subunit of the adaptor complex AP-1. It belongs to the adaptor complexes small subunit family. Adaptor protein (AP) complexes are cytosolic heterotetramers that mediate the sorting of membrane proteins in the secretory and endocytic pathways. AP-1 is found at the cytoplasmic face of coated vesicles located at the Golgi complex, where it mediates both the recruitment of clathrin to the membrane and the recognition of sorting signals within the cytosolic tails of transmembrane receptors.