AP3B2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• AP3B2 Polyclonal antibody, PBS Only (18331-1-PBS)

• 

  WB analysis of rat brain using 18331-1-AP (same clone as 18331-1-PBS)

  rat brain tissue were subjected to SDS PAGE followed by western blot with 18331-1-AP (AP3B2 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 18331-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse brain using 18331-1-AP (same clone as 18331-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 18331-1-AP (AP3B2 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 18331-1-PBS in a different storage buffer formulation.

• 

  IP experiment of mouse brain using 18331-1-AP (same clone as 18331-1-PBS)

  IP result of anti-AP3B2 (IP:18331-1-AP, 4ug; Detection:18331-1-AP 1:500) with mouse brain tissue lysate 3600ug. This data was developed using the same antibody clone with 18331-1-PBS in a different storage buffer formulation.

AP3B2 Polyclonal Antibody for WB, IP, Indirect ELISA

Cat No. 18331-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IP, Indirect ELISA

Synonyms

---

Product Information

18331-1-PBS targets AP3B2 in WB, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12861

  Product name: Recombinant human AP3B2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 650-1082 aa of BC093739

  Sequence: DPSVRNVEVPEWTKCSNREKRKEKEKPFYSDSEGESGPTESADSDPESESESDSKSSSESGSGESSSESDNEDQDEDEEKGRGSESEQSEEDGKRKTKKKVPERKGEASSSDEGSDSSSSSSESEMTSESEEEQLEPASWSRKTPPSSKSAPATKEISLLDLEDFTPPSVQPVSPPAIVSTSLAADLEGLTLTDSTLVPSLLSPVSGVGRQELLHRVAGEGLAVDYTFSRQPFSGDPHMVSVHIHFSNSSDTPIKGLHVGTPKLPAGISIQEFPEIESLAPGESATAVMGINFCDSTQAANFQLCTQTRQFYVSIQPPVGELMAPVFMSENEFKKEQGKLMGMNEITEKLMLPDTCRSDHIVVQKVTATANLGRVPCGTSDEYRFAGRTLTGGSLVLLTLDARPAGAAQLTVNSEKMVIGTMLVKDVIQALTQ

• Full Name: adaptor-related protein complex 3, beta 2 subunit
• Calculated Molecular Weight: 1082 aa, 119 kDa
• Observed Molecular Weight: 120-140 kDa
• GenBank Accession Number: BC093739
• Gene Symbol: AP3B2
• Gene ID (NCBI): 8120
• RRID: AB_2878531
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q13367
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Adaptor protein (AP) complexes are cytosolic heterotetramers that mediate the sorting of membrane proteins in the secretory and endocytic pathways. AP3B2 is a subunit of the AP-3 complex which is composed of two large adaptins (AP3D1 and AP3B1 or AP3B2), a medium adaptin (AP3M1 or AP3M2) and a small adaptin (APS1 or AP3S2). AP-3 complex is associated with the Golgi region as well as more peripheral structures. It facilitates the budding of vesicles from the Golgi membrane and may be directly involved in trafficking to lysosomes.