AP3M2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• AP3M2 Polyclonal antibody, PBS Only (11925-1-PBS)

• 

  WB analysis of Hacat cells (siRNA) using 11925-1-AP (same clone as 11925-1-PBS)

  WB result of AP3M2 antibody (11925-1-AP; 1:500) with siRNA cell lysate. This data was developed using the same antibody clone with 11925-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human brain using 11925-1-AP (same clone as 11925-1-PBS)

  human brain tissue were subjected to SDS PAGE followed by western blot with 11925-1-AP (AP3M2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11925-1-PBS in a different storage buffer formulation.

• 

  IP experiment of mouse brain using 11925-1-AP (same clone as 11925-1-PBS)

  IP result of anti-AP3M2 (IP:11925-1-AP, 4ug; Detection:11925-1-AP 1:300) with mouse brain tissue lysate 3200 ug. This data was developed using the same antibody clone with 11925-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 11925-1-AP (same clone as 11925-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 11925-1-AP (AP3M2 Antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 11925-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 11925-1-AP (same clone as 11925-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 11925-1-AP (AP3M2 Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 11925-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

AP3M2 Polyclonal Antibody for WB, IHC, IP, Indirect ELISA

Cat No. 11925-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, Indirect ELISA

Synonyms

---

Product Information

11925-1-PBS targets AP3M2 in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2572

  Product name: Recombinant human AP3M2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-273 aa of BC056257

  Sequence: MIHSLFLINSSGDIFLEKHWKSVVSRSVCDYFFEAQERATEAENVPPVIPTPHHYLLSVYRHKIFFVAVIQTEVPPLFVIEFLHRVVDTFQDYFGVCSEPVIKDNVVVVYEVLEEMLDNGFPLATESNILKELIKPPTILRTVVNTITGSTNVGDQLPTGQLSVVPWRRTGVKYTNNEAYFDVIEEIDAIIDKSGSTITAEIQGVIDACVKLTGMPDLTLSFMNPRLLDDVSFHPCVRFKRWESERILSFIPPDGNFRLLSYHVSAQKCCLGM

• Full Name: adaptor-related protein complex 3, mu 2 subunit
• Calculated Molecular Weight: 418 aa, 47 kDa
• Observed Molecular Weight: 47 kDa
• GenBank Accession Number: BC056257
• Gene Symbol: AP3M2
• Gene ID (NCBI): 10947
• RRID: AB_10640438
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P53677
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

AP3M2 is a 47-kDa protein that belongs to the adaptor complexes medium subunit family. Adaptor protein (AP) complexes are cytosolic heterotetramers that mediate the sorting of membrane proteins in the secretory and endocytic pathways. AP3M2 is a subunit of the AP-3 complex which is associated with the Golgi region as well as more peripheral structures. AP-3 is implicated in the transport of lysosomal membrane proteins.