AP3S1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• AP3S1 Polyclonal antibody (32945-1-AP)

• 

  WB analysis using 32945-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 32945-1-AP (AP3S1 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of mouse kidney using 32945-1-AP

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse kidney tissue using AP3S1 antibody (32945-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

AP3S1 Polyclonal Antibody for WB, IF-P, ELISA

Cat No. 32945-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF-P, ELISA

Synonyms

Adaptor-related protein complex 3 subunit sigma-1, AP-3 complex subunit sigma-1, AP-3 complex subunit sigma-3A, CLAPS3, Clathrin-associated/assembly/adaptor protein, small 3

---

Tested Applications

• Positive WB detected in: HeLa cells, Jurkat cells
• Positive IF-P detected in: mouse kidney tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000
• Immunofluorescence (IF)-P: IF-P : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

32945-1-AP targets AP3S1 in WB, IF-P, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag37523

  Product name: Recombinant human AP3S1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-193 aa of BC000804

  Sequence: MIKAILIFNNHGKPRLSKFYQPYSEDTQQQIIRETFHLVSKRDENVCNFLEGGLLIGGSDNKLIYRHYATLYFVFCVDSSESELGILDLIQVFVETLDKCFENVCELDLIFHVDKVHNILAEMVMGGMVLETNMNEIVTQIDAQNKLEKSEAGLAGAPARAVSAVKNMNLPEIPRNINIGDISIKVPNLPSFK

• Full Name: adaptor-related protein complex 3, sigma 1 subunit
• Calculated Molecular Weight: 22 kDa
• Observed Molecular Weight: 22 kDa
• GenBank Accession Number: BC000804
• Gene Symbol: AP3S1
• Gene ID (NCBI): 1176
• RRID: AB_3742800
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q92572
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

AP-3 complex subunit sigma-1 (AP3S1) is a component of the heterotetrameric adaptor protein complex-3 (AP-3), which plays a central role in intracellular protein trafficking (PMID: 34565296). AP3S1 is also a potential pan-cancer oncogene and plays an essential role in tumorigenesis and cancer immunity. Elevated expression of AP3S1 indicates an immunosuppressive microenvironment and can be used as a potential prognostic biomarker and a target for immunotherapy (PMID: 35874816; 38609993).