APBA3 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• APBA3 Polyclonal antibody, PBS Only (20812-1-PBS)

• 

  WB analysis using 20812-1-AP (same clone as 20812-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 20812-1-AP (APBA3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20812-1-PBS in a different storage buffer formulation.

APBA3 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 20812-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

MINT3, APBA 3, X11L2, Amyloid-beta A4 precursor protein-binding family A member 3

---

Product Information

20812-1-PBS targets APBA3 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14771

  Product name: Recombinant human APBA3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 341-412 aa of BC008338

  Sequence: IAQAIGQAFAAAYSQFLRESGIDPSQVGVHPSPGARHLHNGDLDHFSNSDNCREVHLEKRRGEGLGVALVES

• Full Name: amyloid beta (A4) precursor protein-binding, family A, member 3
• Calculated Molecular Weight: 575 aa, 61 kDa
• Observed Molecular Weight: 70-75 kDa
• GenBank Accession Number: BC008338
• Gene Symbol: APBA3
• Gene ID (NCBI): 9546
• RRID: AB_3669349
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O96018
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

The APBA (MINT) family is a family of adaptor proteins composed of APBA1 (MINT1), APBA2 (MINT2), and APBA3 (MINT3). These proteins are involved in neuronal protein transport and synaptic function. APBA3 plays an essential role in mediating the transport of APP from the TGN to the plasma membrane (PMID: 24410826).