APBB2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• APBB2 Polyclonal antibody (13177-1-AP)

APBB2 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 13177-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

FE65L, FE65L1, A4, Amyloid-beta, Protein Fe65 like 1

• 

  WB analysis of human brain using 13177-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 13177-1-AP (APBB2 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 13177-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 13177-1-AP (APBB2 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human placenta using 13177-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 13177-1-AP (APBB2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human stomach cancer using 13177-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 13177-1-AP (APBB2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse stomach using 13177-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse stomach tissue slide using 13177-1-AP (APBB2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse pancreas using 13177-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse pancreas tissue slide using 13177-1-AP (APBB2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse kidney using 13177-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 13177-1-AP (APBB2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat kidney using 13177-1-AP

  Immunohistochemical analysis of paraffin-embedded rat kidney tissue slide using 13177-1-AP (APBB2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat stomach using 13177-1-AP

  Immunohistochemical analysis of paraffin-embedded rat stomach tissue slide using 13177-1-AP (APBB2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse kidney using 13177-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 13177-1-AP (APBB2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HT-1080 using 13177-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HT-1080 cells using APBB2 antibody (13177-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of U2OS using 13177-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed U2OS cells using APBB2 antibody (13177-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-phalloidin (red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: HT-1080 cells, human brain tissue, MCF-7 cells, U2OS cells
• Positive IHC detected in: human placenta tissue, human stomach cancer tissue, mouse kidney tissue, mouse pancreas tissue, mouse stomach tissue, rat kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: U2OS cells, HT-1080 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

13177-1-AP targets APBB2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3844

  Product name: Recombinant human APBB2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 386-736 aa of BC027946

  Sequence: SCSINSDPEAKCFAVRSLGWVEMAEEDLAPGKSSVAVNNCIRQLSYCKNDIRDTVGIWGEGKDMYLILENDMLSLVDPMDRSVLHSQPIVSIRVWGVGRDNGRDFAYVARDKDTRILKCHVFRCDTPAKAIATSLHEICSKIMAERKNAKALACSSLQERANVNLDVPLQDFPTPKTELVQKFHVQYLGMLPVDKPVGMDILNSAIENLMTSSNKEDWLSVNMNVADATVTVISEKNEEEVLVECRVRFLSFMGVGKDVHTFAFIMDTGNQRFECHVFWCEPNAGNVSEAVQAACMLRYQKCLVARPPSQKVRPPPPPADSVTRRVTTNVKRGVLSLIDTLKQKRPVTEMP

• Full Name: amyloid beta (A4) precursor protein-binding, family B, member 2
• Calculated Molecular Weight: 83 kDa
• Observed Molecular Weight: 83-95 kDa
• GenBank Accession Number: BC027946
• Gene Symbol: APBB2
• Gene ID (NCBI): 323
• RRID: AB_10638434
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q92870
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.