APCDD1 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 83246-6-RR (same clone as 83246-6-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 83246-6-RR (APCDD1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 83246-6-PBS in a different storage buffer formulation.

• 

  WB analysis using 83246-6-RR (same clone as 83246-6-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 83246-6-RR (APCDD1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 83246-6-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 83246-6-RR

  Biolayer interferometry (BLl) kinetic assays of 83246-6-RR against Human APCDD1 were performed. The affinity constant is 0.634 nM.

APCDD1 Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 83246-6-PBS

Clone No.240085C6

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

Synonyms

Protein APCDD1, FP7019, DRAPC1, B7323, Adenomatosis polyposis coli down-regulated 1 protein

---

Product Information

83246-6-PBS targets APCDD1 in WB, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag10303

  Product name: Recombinant human APCDD1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 141-496 aa of BC053324

  Sequence: TEADYQLHNVQVICHTEAVAEKLGQQVNRTCPGFLADGGPWVQDVAYDLWREENGCECTKAVNFAMHELQLIRVEKQYLHHNLDHLVEELFLGDIHTDATQRMFYRPSSYQPPLQNAKNHDHACIACRIIYRSDEHHPPILPPKADLTIGLHGEWVSQRCEVRPEVLFLTRHFIFHDNNNTWEGHYYHYSDPVCKHPTFSIYARGRYSRGVLSSRVMGGTEFVFKVNHMKVTPMDAATASLLNVFNGNECGAEGSWQVGIQQDVTHTNGCVALGIKLPHTEYEIFKMEQDARGRYLLFNGQRPSDGSSPDRPEKRATSYQMPLVQCASSSPRAEDLAEDSGSSLYGRAPGRHTWSL

• Full Name: adenomatosis polyposis coli down-regulated 1
• Calculated Molecular Weight: 514 aa, 59 kDa
• Observed Molecular Weight: 59 kDa
• GenBank Accession Number: BC053324
• Gene Symbol: APCDD1
• Gene ID (NCBI): 147495
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q8J025
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

APCDD1(adenomatosis polyposis coli down-regulated 1) is a membrane-bound glycoprotein conserved during vertebrate evolution that regulates important biological processes controlled by Wnt signaling (PMID: 26170146). APCDD1 is a membrane-bound glycoprotein that is abundantly expressed in human HFs (hair follicles) and can interact in vitro with WNT3A and LRP5, two essential components of Wnt signaling (PMID: 20393562). APCDD1 may be modified by glycosylation.