APH1B Polyclonal antibody

• Home
• Products
• Primary Antibodies
• APH1B Polyclonal antibody (28175-1-AP)

• 

  WB analysis using 28175-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 28175-1-AP (APH1B antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

APH1B Polyclonal Antibody for WB, ELISA

Cat No. 28175-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

APH 1B, Aph 1beta, APH-1b, Aph-1beta, Gamma secretase subunit APH 1B

---

Tested Applications

• Positive WB detected in: fetal human brain tissue, mouse brain tissue, rat brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

28175-1-AP targets APH1B in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14066

  Product name: Recombinant human APH1B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 196-257 aa of BC020905

  Sequence: HLLVSAQTFISSYYGINLASAFIILVLMGTWAFLAAGGSCRSLKLCLLCQDKNFLLYNQRSR

• Full Name: anterior pharynx defective 1 homolog B (C. elegans)
• Calculated Molecular Weight: 257 aa, 28 kDa
• Observed Molecular Weight: 30 kDa
• GenBank Accession Number: BC020905
• Gene Symbol: APH1B
• Gene ID (NCBI): 83464
• RRID: AB_3742281
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8WW43
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.