APLP2 Recombinant monoclonal antibody, PBS Only (Detector)

APLP2 Uni-rAb® Recombinant Antibody for Cytometric bead array, Indirect ELISA
Cat No. 84703-1-PBS
Clone No.241655F3

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Indirect ELISA

A4, Amyloid beta, Amyloid beta precursor like protein 2, Amyloid like protein 2, Amyloid-like protein 2

Formulation:  PBS Only
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

84703-1-PBS targets APLP2 as part of a matched antibody pair:

MP01505-1: 84703-2-PBS capture and 84703-1-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag6842

Product name: Recombinant human APLP2 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 33-360 aa of BC000373

Sequence: YIEALAANAGTGFAVAEPQIAMFCGKLNMHVNIQTGKWEPDPTGTKSCFETKEEVLQYCQEMYPELQITNVMEANQRVSIDNWCRRDKKQCKSRFVTPFKCLVGEFVSDVLLVPEKCQFFHKERMEVCENHQHWHTVVKEACLTQGMTLYSYGMLLPCGVDQFHGTEYVCCPQTKIIGSVSKEEEEEDEEEEEEEDEEEDYDVYKSEFPTEADLEDFTEAAVDEDDEDEEEGEEVVEDRDYYYDTFKGDDYNEENPTEPGSDGTMSDKEITHDVKAVCSQEAMTGPCRAVMPRWYFDLSKGKCVRFIYGGCGGNRNNFESEDYCMAVC

Predict reactive species
Full Name amyloid beta (A4) precursor-like protein 2
Calculated Molecular Weight 87 kDa
GenBank Accession NumberBC000373
Gene Symbol APLP2
Gene ID (NCBI) 334
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ06481
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.
Loading...
||
New chat Able
正在加载,请稍候...