Apolipoprotein AI Polyclonal antibody

• Home
• Products
• Primary Antibodies
• Apolipoprotein AI Polyclonal antibody (31265-1-AP)

• KD/KO Validated

Apolipoprotein AI Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 31265-1-AP Copied!

Publications (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IF/ICC, ELISA

Synonyms

APOA1, apolipoprotein A I, APOA 1, ApoA I, ApoAI

• 

  WB analysis of HepG2 using 31265-1-AP

  WB result of Apolipoprotein AI antibody (31265-1-AP; 1:3000; incubated at room temperature for 1.5 hours) with sh-Control and sh-Apolipoprotein AI transfected HepG2 cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 31265-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 31265-1-AP (Apolipoprotein AI antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 31265-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 31265-1-AP (Apolipoprotein AI antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 31265-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed HeLa cells using Apolipoprotein AI antibody (31265-1-AP) at dilution of 1:400 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for Apolipoprotein AI in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse liver tissue, HepG2 cells, mouse lung tissue, mouse spleen tissue
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

31265-1-AP targets Apolipoprotein AI in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Eg0757

  Product name: Recombinant Human Apolipoprotein AI protein (His Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: C-6*HIS

  Domain: 25-267 aa of BC005380

  Sequence: DEPPQSPWDRVKDLATVYVDVLKDSGRDYVSQFEGSALGKQLNLKLLDNWDSVTSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQ

• Full Name: apolipoprotein A-I
• Calculated Molecular Weight: 31 kDa
• Observed Molecular Weight: 26 kDa
• GenBank Accession Number: BC005380
• Gene Symbol: APOA1
• Gene ID (NCBI): 335
• RRID: AB_3669923
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: P02647
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ApoA1 is a major protein component of high density lipoproteins (HDL) which is associated with reversed cholesterol transport, lipid/cholesterol binding, lecithin/cholesterol acyltransferase (LCAT) activation and specific receptors binding. It is synthesized in the liver and small intestine. Defects of ApoA1 cause low HDL level and systemic non-neuropathic amyloidosis. Serum concentration of ApoA1 is inversely related to the risk of developing atherosclerosis. This antibody was generated against the C-terminal region of human ApoA1.

Publications

What published studies show

The Apolipoprotein AI Polyclonal antibody (Cat# 31265-1-AP) has 1 total citation. It was cited in Phytomedicine (IF 11.3), in a 2025 study investigating co-administration of berberine and evodiamine for mitigating hepatotoxicity and potentiating colitis treatment. The associated research fields include phytomedicine, hepatotoxicity, and inflammatory bowel disease. The antibody was used for Western Blot (WB) in this publication.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
	WB	Phytomedicine; Co-administration of berberine and evodiamine: Mitigating evodiamine-induced hepatotoxicity and potentiating colitis treatment; Authors - Xiaoyu Tao