APOBEC1 Polyclonal antibody

• 

  WB analysis using 32857-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 32857-1-AP (APOBEC1 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

APOBEC1 Polyclonal Antibody for WB, ELISA

Cat No. 32857-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

APO1, APOBEC-1, Apolipoprotein B mRNA-editing enzyme 1, Apolipoprotein B mRNA-editing enzyme catalytic subunit 1, C->U-editing enzyme APOBEC-1

---

Tested Applications

• Positive WB detected in: HepG2 cells, L02 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

32857-1-AP targets APOBEC1 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26715

  Product name: Recombinant human APOBEC1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-135 aa of NM_001304566

  Sequence: MTSEKGPSTGDPTLRRRIEPWEFDVFYDPRELRKEACLLYEIKWGMSRKIWRSSGKNTTNHVEVNFIKKFTSERDFHPSMSCSITWFLSWSPCWECSQAIREFLSRHPGVTLVIYVARLFWHMDQQNRQGLRDLV

• Full Name: apolipoprotein B mRNA editing enzyme, catalytic polypeptide 1
• Calculated Molecular Weight: 28 kDa
• Observed Molecular Weight: 25 kDa
• GenBank Accession Number: NM_001304566
• Gene Symbol: APOBEC1
• Gene ID (NCBI): 339
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: P41238
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Apolipoprotein B mRNA-editing enzyme catalytic subunit 1 (APOBEC1) is a member of the cytidine deaminase enzyme family. It forms a multiple-protein editing holoenzyme with APOBEC1 complementation factor (ACF) and APOBEC1 stimulating protein (ASP) (PMID: 30844405). This holoenzyme is involved in the editing of C-to-U nucleotide bases in apolipoprotein B and neurofibromatosis-1 mRNAs (PMID: 24916387; 11727199). APOBEC1 plays a crucial role in RNA editing, which is essential for the proper function of these proteins. Additionally, APOBEC1 has been implicated in various cellular processes, including the regulation of gene expression and the maintenance of genomic stability (PMID: 33094286).