APOBEC3A Recombinant monoclonal antibody

• 

  IF Staining of THP-1 using 84239-2-RR

  Immunofluorescent analysis of (4% PFA) fixed THP-1 cells using APOBEC3A antibody (84239-2-RR, Clone: 241529F1 ) at dilution of 1:250 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

• 

  Affinity and Kinetic Characterization of 84239-2-RR

  Biolayer interferometry (BLl) kinetic assays of 84239-2-RR against Human APOBEC3A were performed. The affinity constant is below 1 pM.

APOBEC3A Uni-rAb^® Recombinant Antibody for IF/ICC, ELISA

Cat No. 84239-2-RR

Clone No.241529F1

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC, ELISA

Synonyms

PHO1, EC:3.5.4.38, DNA dC->dU-editing enzyme APOBEC-3A, ARP3, A3A

---

Tested Applications

• Positive IF/ICC detected in: THP-1 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:125-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

84239-2-RR targets APOBEC3A in IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag18845

  Product name: Recombinant human APOBEC3A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-61 aa of BC126416

  Sequence: MEASPASGPRHLMDPHIFTSNFNNGIGRHKTYLCYEVERLDNGTSVKMDQHRGFLHNQAKN

• Full Name: apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3A
• Calculated Molecular Weight: 199 aa, 23 kDa
• GenBank Accession Number: BC126416
• Gene Symbol: APOBEC3A
• Gene ID (NCBI): 200315
• RRID: AB_3671791
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P31941
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

APOBEC3A, also known as A3A, belongs to the cytidine and deoxycytidylate deaminase family. APOBEC3A plays a role in immunity, by restricting transmission of foreign DNA such as viruses. One mechanism of foreign DNA restriction is deamination of foreign double-stranded DNA cytidines to uridines, which leads to DNA degradation. However, other mechanisms are also thought to be involved, as anti-viral effect is not dependent on deaminase activity. APOBEC3A is expressed in several cell types, including keratinocytes and myeloid cells (PMID: 28825669). APOBEC3A has 2 isoforms with the molecular mass of 22 and 23 kDa.