APOC4 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• APOC4 Polyclonal antibody, PBS Only (16530-1-PBS)

• 

  WB analysis of human plasma using 16530-1-AP (same clone as 16530-1-PBS)

  human plasma were subjected to SDS PAGE followed by western blot with 16530-1-AP (APOC4 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16530-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 16530-1-AP (same clone as 16530-1-PBS)

  Immunofluorescent analysis of HepG2 cells using 16530-1-AP (APOC4 antibody) at dilution of 1:25 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 16530-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

APOC4 Polyclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 16530-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

16530-1-PBS targets APOC4 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9780

  Product name: Recombinant human APOC4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 26-127 aa of BC020723

  Sequence: ACQPEAQEGTLSPPPKLKMSRWSLVRGRMKELLETVVNRTRDGWQWFWSPSTFRGFMQTYYDDHLRDLGPLTKAWFLESKDSLLKKTHSLCPRLVCGDKDQG

• Full Name: apolipoprotein C-IV
• Calculated Molecular Weight: 127 aa, 15 kDa
• Observed Molecular Weight: 17 kDa
• GenBank Accession Number: BC020723
• Gene Symbol: APOC4
• Gene ID (NCBI): 346
• RRID: AB_2878271
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P55056
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.