Product Information
16530-1-PBS targets APOC4 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag9780 Product name: Recombinant human APOC4 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 26-127 aa of BC020723 Sequence: ACQPEAQEGTLSPPPKLKMSRWSLVRGRMKELLETVVNRTRDGWQWFWSPSTFRGFMQTYYDDHLRDLGPLTKAWFLESKDSLLKKTHSLCPRLVCGDKDQG Predict reactive species |
| Full Name | apolipoprotein C-IV |
| Calculated Molecular Weight | 127 aa, 15 kDa |
| Observed Molecular Weight | 17 kDa |
| GenBank Accession Number | BC020723 |
| Gene Symbol | APOC4 |
| Gene ID (NCBI) | 346 |
| RRID | AB_2878271 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P55056 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |



