APOD Monoclonal antibody, PBS Only

• 

  WB analysis of human plasma using 66215-1-Ig (same clone as 66215-1-PBS)

  human plasma were subjected to SDS PAGE followed by western blot with 66215-1-Ig (APOD Antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66215-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 66215-1-Ig (same clone as 66215-1-PBS)

  human urine sample were subjected to SDS PAGE followed by western blot with 66215-1-Ig (APOD antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66215-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human placenta using 66215-1-Ig (same clone as 66215-1-PBS)

  human placenta tissue were subjected to SDS PAGE followed by western blot with 66215-1-Ig (APOD antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66215-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 66215-1-Ig (same clone as 66215-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed HepG2 cells using APOD antibody (66215-1-Ig, Clone: 1C6D10 ) at dilution of 1:800 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 66215-1-PBS in a different storage buffer formulation.

• 

  FC experiment of HepG2 using 66215-1-Ig (same clone as 66215-1-PBS)

  1X10^6 HepG2 cells were intracellularly stained with 0.4 ug Anti-Human APOD (66215-1-Ig, Clone:1C6D10) and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Mouse IgG1 Isotype Control (MOPC-21) (65124-1-Ig, Clone: MOPC-21) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 66215-1-PBS in a different storage buffer formulation.

APOD Monoclonal Antibody for WB, IF/ICC, FC (Intra), Indirect ELISA

Cat No. 66215-1-PBS

Clone No.1C6D10

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, IF/ICC, FC (Intra), Indirect ELISA

Synonyms

1C6D10, Apo D, Apo-D, apolipoprotein D

---

Product Information

66215-1-PBS targets APOD in WB, IF/ICC, FC (Intra), Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag21422

  Product name: Recombinant human APOD protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 15-189 aa of BC007402

  Sequence: FGAAEGQAFHLGKCPNPPVQENFDVNKYLGRWYEIEKIPTTFENGRCIQANYSLMENGKIKVLNQELRADGTVNQIEGEATPVNLTEPAKLEVKFSWFMPSAPYWILATDYENYALVYSCTCIIQLFHVDFAWILARNPNLPPETVDSLKNILTSNNIDVKKMTVTDQVNCPKLS

• Full Name: apolipoprotein D
• Calculated Molecular Weight: 33 kDa
• Observed Molecular Weight: 30-33 kDa
• GenBank Accession Number: BC007402
• Gene Symbol: APOD
• Gene ID (NCBI): 347
• RRID: AB_2881606
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P05090
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Apolipoprotein D (ApoD) is a member of the lipocalin superfamily of ligand transporters, and has been implicated in the transport of small hydrophobic molecules. ApoD is also a component of plasma high-density lipoproteins (HDL). Alteration of ApoD expression has been linked to multiple neurological disorders, including Alzheimer's disease.