APOD Recombinant monoclonal antibody

• 

  WB analysis of human plasma using 86500-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 86500-1-RR (APOD antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human placenta using 86500-1-RR

  human placenta tissue were subjected to SDS PAGE followed by western blot with 86500-1-RR (APOD antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 86500-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 86500-1-RR (APOD antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  Affinity and Kinetic Characterization of 86500-1-RR

  Biolayer interferometry (BLl) kinetic assays of 86500-1-RR against Human APOD were performed. The affinity constant is below 1 pM.

APOD Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 86500-1-RR

Clone No.251229A10

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

Apo D, Apo-D, apolipoprotein D

---

Tested Applications

• Positive WB detected in: human plasma, human placenta tissue, human urine

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

86500-1-RR targets APOD in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag0812

  Product name: Recombinant human APOD protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 15-189 aa of BC007402

  Sequence: FGAAEGQAFHLGKCPNPPVQENFDVNKYLGRWYEIEKIPTTFENGRCIQANYSLMENGKIKVLNQELRADGTVNQIEGEATPVNLTEPAKLEVKFSWFMPSAPYWILATDYENYALVYSCTCIIQLFHVDFAWILARNPNLPPETVDSLKNILTSNNIDVKKMTVTDQVNCPKLS

• Full Name: apolipoprotein D
• Calculated Molecular Weight: 33 kDa
• Observed Molecular Weight: 21-33 kDa
• GenBank Accession Number: BC007402
• Gene Symbol: APOD
• Gene ID (NCBI): 347
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P05090
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Apolipoprotein D (ApoD) is a member of the lipocalin superfamily of ligand transporters, and has been implicated in the transport of small hydrophobic molecules. ApoD is also a component of plasma high-density lipoproteins (HDL). Alteration of ApoD expression has been linked to multiple neurological disorders, including Alzheimer's disease.