Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated APOE Monoclonal antibody

APOE Monoclonal Antibody for IF/ICC, FC (Intra)

Cat No. CL488-66830
Clone No.1B2C9

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse

Applications

IF/ICC, FC (Intra)

1B2C9, Apo E, Apo-E, apoe4, apolipoprotein E

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHepG2 cells
Positive FC (Intra) detected inHepG2 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-66830 targets APOE in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag28186

Product name: Recombinant human APOE protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 66-317 aa of BC003557

Sequence: QEELLSSQVTQELRALMDETMKELKAYKSELEEQLTPVAEETRARLSKELQAAQARLGADMEDVCGRLVQYRGEVQAMLGQSTEELRVRLASHLRKLRKRLLRDADDLQKRLAVYQAGAREGAERGLSAIRERLGPLVEQGRVRAATVGSLAGQPLQERAQAWGERLRARMEEMGSRTRDRLDEVKEQVAEVRAKLEEQAQQIRLQAEAFQARLKSWFEPLVEDMQRQWAGLVEKVQAAVGTSAAPVPSDNH

Predict reactive species
Full Name Apolipoprotein E
Calculated Molecular Weight 36 kDa
Observed Molecular Weight 34-36 kDa
GenBank Accession NumberBC003557
Gene Symbol APOE
Gene ID (NCBI) 348
RRIDAB_2919377
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP02649
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

The apolipoprotein E (APOE) is a 299-amino acid polypeptide that mediates the binding, internalization, and catabolism of lipoprotein particles, and also serve as a ligand for the LDL (APO B/E) receptor and for the specific APOE receptor (chylomicron remnant) of hepatic tissues. The very strong association of the APOE ɛ4 allele with AD risk and its role in the accumulation of amyloid β in brains of people and animal models solidify the biological relevance of APOE isoforms but do not provide mechanistic insight.

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 APOE antibody CL488-66830Download protocol
IF protocol for CL Plus 488 APOE antibody CL488-66830Download protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle

bioRxiv

Immune cells regulate circulating adipocyte extracellular vesicle levels in response to metabolic shifts

Authors - Snigdha Tiash
Loading...
||
New chat

Able

正在加载,请稍候...