APOOL Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• APOOL Polyclonal antibody, PBS Only (28514-1-PBS)

• 

  WB analysis using 28514-1-AP (same clone as 28514-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 28514-1-AP (APOOL antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 28514-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 28514-1-AP (same clone as 28514-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 28514-1-AP (APOOL antibody) at dilution of 1:300 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28514-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 28514-1-AP (same clone as 28514-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 28514-1-AP (APOOL antibody) at dilution of 1:300 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28514-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human placenta using 28514-1-AP (same clone as 28514-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 28514-1-AP (APOOL antibody) at dilution of 1:300 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28514-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human placenta using 28514-1-AP (same clone as 28514-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 28514-1-AP (APOOL antibody) at dilution of 1:300 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28514-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 28514-1-AP (same clone as 28514-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using APOOL antibody (28514-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 28514-1-PBS in a different storage buffer formulation.

APOOL Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 28514-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

28514-1-PBS targets APOOL in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag29392

  Product name: Recombinant human APOOL protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 127-268 aa of BC107096

  Sequence: VSARKGSKFKKITYPLGLATLGATVCYPVQSVIIAKVTAKKVYATSQQIFGAVKSLWTKSSKEESLPKPKEKTKLGSSSEIEVPAKTTHVLKHSVPLPTELSSEAKTKSESTSGATQFMPDPKLMDHGQSHPEDIDMYSTRS

• Full Name: apolipoprotein O-like
• Calculated Molecular Weight: 268 aa, 29 kDa
• Observed Molecular Weight: 30 kDa
• GenBank Accession Number: BC107096
• Gene Symbol: APOOL
• Gene ID (NCBI): 139322
• RRID: AB_3086061
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6UXV4
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

APOOL, the component of the MICOS complex, is a large protein complex of the mitochondrial inner membrane that plays crucial roles in the maintenance of crista junctions, inner membrane architecture, and formation of contact sites to the outer membrane. Specifically binds to cardiolipin (in vitro) but not to the precursor lipid phosphatidylglycerol. Plays a crucial role in crista junction formation and mitochondrial function (PubMed:23704930), (PubMed:25764979). Its molecular weight is about 30 kDa.