APP Recombinant monoclonal antibody, PBS Only (Detector)

• 

  Sandwich ELISA standard curve of MP01584-3

  Sandwich ELISA standard curve of MP01584-3, Human APP Recombinant Matched Antibody Pair - PBS only. 84829-1-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Ag22408. 84829-3-PBS was HRP conjugated as the detection antibody. Range: 0.391-25 ng/mL

• 

  Sample test of MP01584-3

  The mean APP concentration was determined to be 23.24 ng/mL in SH-SY5Y cell extract based on a 1.0 mg/mL extract load and 9.46 ng/mL in U-87MG cell extract based on a 1.0 mg/mL extract load.

• 

  Sample test of MP01584-3

  Serum of six individual healthy human donors was measured. The human APP concentration of detected samples was determined to be 8.66 ng/mL with a range of 1.49 - 19.08 ng/mL.

APP Uni-rAb^® Recombinant Antibody for Sandwich ELISA, Indirect ELISA, Sample test

Cat No. 84829-3-PBS

Clone No.242316F6

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Sandwich ELISA, Indirect ELISA, Sample test

Synonyms

amyloid precursor protein, A4 amyloid protein, AB40, AB42, AD1

---

Product Information

84829-3-PBS targets APP as part of a matched antibody pair:

MP01584-3: 84829-1-PBS capture and 84829-3-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag22408

  Product name: Recombinant human APP protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 653-751 aa of BC065529

  Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIATVIVITLVMLKKKQYTSIHHGVVEVDAAVTPEERHLSKMQQNGYENPTYKFFEQMQN

• Full Name: amyloid beta (A4) precursor protein
• GenBank Accession Number: BC065529
• Gene Symbol: APP
• Gene ID (NCBI): 351
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P05067
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.