Anti-Mouse APRIL/TNFSF13 Rabbit Recombinant Antibody, PBS Only

• 

  FC experiment of Transfected HEK-293T using 98331-2-RR (same clone as 98331-2-PBS)

  1x10^6 HEK-293T cells or APRIL/TNFSF13 transfected HEK-293T cells were intracellularly stained with 0.25 ug Anti-Mouse APRIL/TNFSF13 Rabbit RecAb (98331-2-RR, Clone: 241666F9) and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 98331-2-PBS in a different storage buffer formulation.

• 

  FC experiment of Transfected HEK-293T using 98331-2-RR (same clone as 98331-2-PBS)

  1x10^6 HEK-293T cells or APRIL/TNFSF13 transfected HEK-293T cells were intracellularly stained with 0.25 ug Anti-Mouse APRIL/TNFSF13 Rabbit RecAb (98331-2-RR, Clone:241666F9) and PE-Conjugated Goat Anti-Rabbit IgG(H+L) (red), or 0.25 ug Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 98331-2-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 98331-2-RR

  Biolayer interferometry (BLl) kinetic assays of 98331-2-RR against Mouse APRIL/TNFSF13 were performed. The affinity constant is 0.228 nM.

APRIL/TNFSF13 Uni-rAb^® Recombinant Antibody for FC (Intra)

Cat No. 98331-2-PBS

Clone No.241666F9

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

FC (Intra)

Synonyms

241666F9, A proliferation-inducing ligand, APRIL, CD256, Tnfsf13

---

Product Information

98331-2-PBS targets APRIL/TNFSF13 in FC (Intra) applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg1561

  Product name: Recombinant Mouse APRIL/TNFSF13 protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-N-rFc

  Tag: N-rFc

  Domain: 96-241 aa of NM_023517.2

  Sequence: AVLTQKHKKKHSVLHLVPVNITSKADSDVTEVMWQPVLRRGRGLEAQGDIVRVWDTGIYLLYSQVLFHDVTFTMGQVVSREGQGRRETLFRCIRSMPSDPDRAYNSCYSAGVFHLHQGDIITVKIPRANAKLSLSPHGTFLGFVKL

• Full Name: tumor necrosis factor (ligand) superfamily, member 13
• Calculated Molecular Weight: 27kDa
• GenBank Accession Number: NM_023517.2
• Gene Symbol: Tnfsf13
• Gene ID (NCBI): 69583
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9D777
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

TNFSF13 gene encodes tumor necrosis factor ligand superfamily member 13 (or APRIL) belonging to the tumor necrosis factor (TNF) family. APRIL is highly expressed in transformed cell lines, cancers of colon, thyroid, lymphoid tissues and specifically expressed in monocytes and macrophages, and its precursor is cleaved by furin. APRIL may be implicated in the regulation of tumor cell growth and also monocyte/macrophage-mediated immunological processes.